SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449676835|ref|XP_002155905.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449676835|ref|XP_002155905.2|
Domain Number 1 Region: 351-386
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000451
Family EGF-type module 0.015
Further Details:      
 
Domain Number 2 Region: 275-312
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000811
Family EGF-type module 0.014
Further Details:      
 
Domain Number 3 Region: 313-349
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000196
Family EGF-type module 0.01
Further Details:      
 
Domain Number 4 Region: 160-201
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000118
Family EGF-type module 0.018
Further Details:      
 
Domain Number 5 Region: 387-424
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000005
Family EGF-type module 0.015
Further Details:      
 
Domain Number 6 Region: 196-237
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000589
Family EGF-type module 0.02
Further Details:      
 
Domain Number 7 Region: 238-274
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000357
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|449676835|ref|XP_002155905.2|
Sequence length 447
Comment PREDICTED: neurogenic locus notch protein homolog, partial [Hydra magnipapillata]
Sequence
MTNNNIKQELTTTTLEKDLGILILNDLKWKLQIKITSSIANYKFEFEKQVWSPYFEKIIN
ILEKIQKRVTKSVPELRHLSYSERLEKMKLTSLKQRRTRGNLKQMYKWYYDIEKITWKIP
PQHSGPCSNIRVEQGIFPQTLKLAKVKPILKSGDIENIDNVNDCKSSPCVHGSCEDLSSD
YKCKCSKHWSGKNCSINISHCTESLCSNEAKCFSEDDDDYICICKKGWGGKNCTIDVTDN
CISNSCLNNSTCQDLVNNNTCKCEKDWKCINWEIDGFPCANDPCMNNGTCQSLNGDYMCL
CKEEWSGKNCNTSFCSNQPCKNAGRCVNIEKDYKCECAKNWQGRNCDVYFECFPNPCLNF
GRCVSLVNDYHCICDNQWTGKNCDKKMSPCSSLPCNNGATCQTTGNDFKCMCKPGCSGRT
CDTQTLLCEKINYSNNGICTEIENDFK
Download sequence
Identical sequences gi|449676835|ref|XP_002155905.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]