SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449676891|ref|XP_002159375.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449676891|ref|XP_002159375.2|
Domain Number 1 Region: 123-363
Classification Level Classification E-value
Superfamily vWA-like 4.45e-61
Family Integrin A (or I) domain 0.00000397
Further Details:      
 
Domain Number 2 Region: 625-707
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.0000000000000144
Family Integrin beta tail domain 0.0011
Further Details:      
 
Domain Number 3 Region: 372-449
Classification Level Classification E-value
Superfamily Integrin domains 0.00000000309
Family Integrin domains 0.0025
Further Details:      
 
Domain Number 4 Region: 23-76
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000133
Family Plexin repeat 0.0026
Further Details:      
 
Domain Number 5 Region: 536-576
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000816
Family Integrin beta EGF-like domains 0.0045
Further Details:      
 
Domain Number 6 Region: 584-620
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000335
Family Integrin beta EGF-like domains 0.0097
Further Details:      
 
Weak hits

Sequence:  gi|449676891|ref|XP_002159375.2|
Domain Number - Region: 501-524
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00614
Family Integrin beta EGF-like domains 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|449676891|ref|XP_002159375.2|
Sequence length 791
Comment PREDICTED: integrin beta-1-like, partial [Hydra magnipapillata]
Sequence
MDVLSFLYFIFVLQLWYVEIKGNFNDCQTKEDCGACIKSVSPQCAWCEDIFYNYTLKNFY
KKCDLLENHEKQKCIKITNPPSSSKIEKAAQLEGETRVSPQAITVKLRPGQPVSVDIEVK
TPKNFPIDLYYLMDMSTSMKEDLANIQTLGEALANELDQVTENFRLGFGLFVDKDIGPYT
WFWNEKIRSDTSVQQTFSFKNRLPLNENKALFGEAVKNTKISYNVDSPEGSLEALLQVVV
CEKEIGWRNKKKARRIVILTTDGTFHFSGDGLLGGFVLPSDGKCHLENNDYIGWNKFDYP
SLSQIRALMVENEIVPIFATTGNTDLYNKVANFFGQASGAVAARLNNDSSNVVPLIKEAY
LKIAQIVNIRADPPKGVDIKFRAKCSKGKLTLDQSFCNDVDIGEQVTFSAEMKTSDCSNA
EKDLDFLIKTSFDDVSVKLQVICECPCGNTSIQNSEQCSKRGNLSCGICFCDKEKFAGRF
CQCTLEEANNQTLCRVPNVESVCSGKGDCECGECICNKGMLNEFGEIDHIYGDQCQCSNT
TCGRSNGGKLCGGPDRGMCDCGKCLCNANWQGNACEEQCDKGTSMCMNNDGVECSGKGTC
KCNNCVCNAGYIGDLCQECVSNCPDACQDFRECVKCKVFDTSDLNKEQCELECAKWNISS
FKLQDKVPEVRRCIVRDEDDCSFVFSYNKNNITGEIELLVQRERICPAEPDILAIILGVI
AGIVGIGLALLLIWKLLATIQDRREFARFDKETKNAKWNTGENPIFKQATSTFQNPMYGN
QPQETPEEHVS
Download sequence
Identical sequences gi|449676891|ref|XP_002159375.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]