SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449677099|ref|XP_004208777.1| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449677099|ref|XP_004208777.1|
Domain Number 1 Region: 189-238
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000235
Family TSP-1 type 1 repeat 0.0007
Further Details:      
 
Domain Number 2 Region: 388-445
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000262
Family TSP-1 type 1 repeat 0.00042
Further Details:      
 
Domain Number 3 Region: 330-388
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000288
Family TSP-1 type 1 repeat 0.00085
Further Details:      
 
Domain Number 4 Region: 128-180
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000249
Family TSP-1 type 1 repeat 0.00085
Further Details:      
 
Domain Number 5 Region: 8-53
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000288
Family TSP-1 type 1 repeat 0.00038
Further Details:      
 
Domain Number 6 Region: 69-126
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000183
Family TSP-1 type 1 repeat 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|449677099|ref|XP_004208777.1|
Sequence length 450
Comment PREDICTED: semaphorin-5A-like [Hydra magnipapillata]
Sequence
MFTLRRYIDGRYGPWSDWGLCSVSCGFGGIKNRSRECNNPEPQYGGLKCSEQPELGSDID
TISCNFVQCPVNGMWCAWKEWSECSSPCGIGKKSKQRECDCPYPQYGGQVCKGQSAEEAD
CFEKNCAINGNVTLWSVWSPCSRTCSNGTRFRTRDCANPSPRFGGSDCRNIGPLEQVEEC
YNILECPEDGNWSPWSGWSECSRTCGDGFQYRNRSCTNPPPTNGGKVCDKNSWEILYCKL
AECCDVMYTSIGCFKDPGTEPRPLPDLLFTDNDPDNFIESGKPIHSLDYQGSITDLVCRY
FDCKSELKGTQEKDSSLNAESKKVLQMAVSVDGNYSEWSSWSSCSHKCGLGDRFRSRSCT
NPKPAFGGKFCSDLGPSHEVTECKDADCPVNGIWSSWSLFSECSATCGEGSRNRTRFCNS
PPPSNGGLNCIGSNVTIELCEVEKCKGRNN
Download sequence
Identical sequences gi|449677099|ref|XP_004208777.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]