SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449677268|ref|XP_004208817.1| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449677268|ref|XP_004208817.1|
Domain Number 1 Region: 178-232
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000887
Family EGF-type module 0.013
Further Details:      
 
Domain Number 2 Region: 220-260
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000124
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 3 Region: 258-312
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000916
Family TSP-1 type 1 repeat 0.0024
Further Details:      
 
Domain Number 4 Region: 74-113
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000838
Family EGF-type module 0.0067
Further Details:      
 
Domain Number 5 Region: 121-161
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000837
Family EGF-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|449677268|ref|XP_004208817.1|
Sequence length 319
Comment PREDICTED: EGF-like module-containing mucin-like hormone receptor-like 1-like [Hydra magnipapillata]
Sequence
MKLSLFSLDPELGMESVNSKSKNNTVCEINKEDSQSSTTDDNCLPIDIWAFLTCLINQRL
GAQKYRIWVIEYPRDIDECYLGISDCDLDNGNCINLDGFFDCMCNPGYVANITEHHYGCL
DENECITIGCYNSTSVSAACFNEVGCFTCTCPRGYTGNGYMLDTQYLSAKGPVNGTGCND
IDECLQNPCAPNENCTNTIGSYNCFCDPQFFTITEYNECQDIDECALGTASCPKHSTCQN
KNGGYTCVCDKLYSGPQCEFDGYWSEWRSIGNCSVPCGSGLVQQVRSCLLGSNCNTYPVG
YERTRICNTELCSNGMSFY
Download sequence
Identical sequences gi|449677268|ref|XP_004208817.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]