SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449677846|ref|XP_002170373.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449677846|ref|XP_002170373.2|
Domain Number 1 Region: 2465-2645
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1e-21
Family Laminin G-like module 0.019
Further Details:      
 
Domain Number 2 Region: 2645-2812
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.48e-16
Family Laminin G-like module 0.0056
Further Details:      
 
Domain Number 3 Region: 2837-2978
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000306
Family Laminin G-like module 0.021
Further Details:      
 
Domain Number 4 Region: 3223-3313
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000106
Family Laminin G-like module 0.008
Further Details:      
 
Domain Number 5 Region: 383-431
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000837
Family Laminin-type module 0.019
Further Details:      
 
Domain Number 6 Region: 1259-1309
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000335
Family Laminin-type module 0.0075
Further Details:      
 
Domain Number 7 Region: 1630-1681
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000159
Family Laminin-type module 0.028
Further Details:      
 
Domain Number 8 Region: 1171-1219
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000307
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 9 Region: 71-130
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000474
Family EGF-type module 0.066
Further Details:      
 
Domain Number 10 Region: 1679-1722
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000837
Family Laminin-type module 0.0025
Further Details:      
 
Domain Number 11 Region: 337-385
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000156
Family Laminin-type module 0.026
Further Details:      
 
Domain Number 12 Region: 128-184
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000184
Family Laminin-type module 0.049
Further Details:      
 
Domain Number 13 Region: 429-477
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000229
Family Laminin-type module 0.031
Further Details:      
 
Domain Number 14 Region: 198-245
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000234
Family Laminin-type module 0.02
Further Details:      
 
Domain Number 15 Region: 1729-1776
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000307
Family Laminin-type module 0.0049
Further Details:      
 
Domain Number 16 Region: 1307-1348
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000698
Family Laminin-type module 0.02
Further Details:      
 
Domain Number 17 Region: 297-339
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00001
Family Laminin-type module 0.02
Further Details:      
 
Domain Number 18 Region: 1778-1827
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000268
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 19 Region: 1221-1256
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000446
Family Laminin-type module 0.028
Further Details:      
 
Domain Number 20 Region: 243-292
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000502
Family Laminin-type module 0.0094
Further Details:      
 
Domain Number 21 Region: 585-622
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000725
Family Laminin-type module 0.094
Further Details:      
 
Domain Number 22 Region: 1578-1622
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000725
Family Laminin-type module 0.0088
Further Details:      
 
Weak hits

Sequence:  gi|449677846|ref|XP_002170373.2|
Domain Number - Region: 489-535
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000229
Family Laminin-type module 0.015
Further Details:      
 
Domain Number - Region: 2271-2427
Classification Level Classification E-value
Superfamily Tropomyosin 0.00621
Family Tropomyosin 0.0064
Further Details:      
 
Domain Number - Region: 533-582
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0176
Family Laminin-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|449677846|ref|XP_002170373.2|
Sequence length 3342
Comment PREDICTED: laminin subunit alpha-like, partial [Hydra magnipapillata]
Sequence
IHISLINGRPGASNFSYSKTLQEWTSASNIRFRFMDIKTLLDDLLPLSLQDPTVTRRYYY
SIKDISIGGRCMCNGFSDECRPTDVIGQYKCDCQYNSYGPRCEECKPGFVQKKWRTRRDK
DDFVCEKCNCHEHTEECEYNEDIEQRKLSLDINGVYSGGGVCKNCQHNTDGINCEKCKPF
FYRPSGVKVTDVNTCQACNCDTQFSTGLCAEGTGQCECKPQYTGRFCKECNNGFHSYPKC
IPCECNVKGSLDGQCALNPETGCQCKRGFGGKFCDEYLPGYFGFPSCQPCNCITRFGAVD
GNCNRTSGQCKCKFGFSGRSCEKCDSGFYLFPYCKECGCDVAKTLDTVCAPGNGKCDCKP
GYDGEKCETCAPMFYGHPACFNCECSVAGSQTPVCDIDSGECACRPNFAGLKCDRCAPGF
YGYPSCAPCNCSIEGARSTVCNEVTGDCNCKTTYTSRQCNKCTRGFYGFPFCKQCNCNPA
GTDSGQEGWSGDCSTNNDGQCVCKKNVQGLECSECKAGFFNLQESDDLGCESCGCFQPGT
NNGITSCSANGNCACKVFVDGNKCKNCLPGYYKLEEKNFFGCEGCDCDEGGSLNSNCLNG
QCFCKSNIVGQKCDRPAANFYFSTLWHIKSEVEDGKTKDGDAVRFDYQESSFPGYSWKGY
VPINDVQQSVVIDLNVKKESKYHVLFKYALNQIQPIVGNIRIFKGNQEHQGLINFPSTQR
STVIKTSISLVKESSGSPKYFTLEPGKWKVEFTSQVSALLLDYIVLVPQDYAQPKTLTKR
VQNPCDATKIERFCNIYQYVPFEKQQGYITIQAEDPTVLSKKTVVPFFNDSKILEKLDYQ
AMVQFSPEFKNHDIVFQFKNLGKYVVVLQYFHDGESEKYLDIYIRSRTGIQQGKSWLYKC
PYTFGCRQVVLDRDFMDVNVFEISDYKTHMLTIIPRQDATFGLDAITFIPLDEWNLDTVT
PQLYCTAKNLKCIPTKFDEPKNSRIVVPDSVEGEPRPSYIIDPDVKVKYLEPGTNSFDIT
DLKPGRYHLMVHYYQPNHQSFDVSTGIYSDRNSIQPGTLHMKHCPNLNGCREMMKQTETK
DVFLFESSRARLRFDIPMQKNGWIEKVYLIPENSESLNQPDLYQGQPITLSDEFNDICTK
NFYDINESSSEFCKKAVFTLTSNFNNGALSCECNEQGSKSSQCSELGGQCPCKENIIGRT
CTRCKMGFYGFPNCKPCSCSNCDSVSGRCSCPPGVEGDNCDRCMKGTFGFDPVIGCQPCS
CDSTGAIDNNTTCNVVTGQCNCKKNFGSRKCSECEKGFFNYPLCQECDCHSAGLKGEKCD
AVTGDCICQDSVVGTRCDECMKGYFKTKSEKGEQLCLKCWCSGHTTECKEAQVYRGVAVR
GTKWTISNVNQSVFQLPLGKLVTNFSEKNSANIIYWISPQEYLGNHVESYGGSFMYNFRY
TTKMTSQTLNDLPDVIIQGNGLSIKNKKQNPRYANQDNTFIFPLVENEWLLDDVYPVSRI
QLLDVLAKISSVKIRATHDANIATSSIWNVTLDSSNINGEEMVFGIEECVCPDGYTGPGC
TKCSPGYSMQANGTCGKCDCMGRSDKCDAETGVCQDCVGNFFGNHCQECKPGFYGKDCAP
CPCPSVHLTGNFADSCAISLNTSELICKCKQGYVGAKCESCADGYYGNPTEPGGSCKLCS
CSGNVNLNLSGNCDPVTGTCKKCLNNTDGDHCEKCKSGFYGKLDNCKDCVCNTCGSSGIS
CSSTTGQCQCKTNVEGKQCDRCKPQTWNFNSCQGCQDCNCGLASESKDCDALTGECKCLP
TVEGKKCDWCKLGYFNYSLSGCQKCSCPNGGFCDVITGSCDCDLSENKCSLCPPGYLIEN
DSCVECDSCVQNTLNKVNHLMKNIKLVEESVYSSGSISQSSLSEINDTLQRLLGNEKIIS
DDFETLKKATGFKNMGTKPDDTKMHTVSEFKGCFFEVEESCPPTLAKVLLSTEAKLNVTE
KNVVQLEEDAYKTSRNASDTKERAEEILARLNLLIKDVENTLLSANDTLGNIKIGEVDAE
KVLADAKKILDEIKGRNFSQTISAVDKESNFSINNKKVSDELKQTALNTSKRAENFNDTF
QDFLAAFINIKKESETALLISQNATDLISLAKSFNIKSLLEMASNLSKDINITIENADEI
LKNGEKALVVAKLVYTEFYNKTGVLGELIKRLRALVDDLRNSLVTSTPTVHQAVEHAKSL
KELADKLKRLLQDTQMFAEAALRAAKVYANIVDAIYEALDAAKLANSSTFNAQDKALQAK
KNAVSSKSKSEAIAFEGSELKAKVDDVKISLDGIKKRLADIKKLREGIEKRVLNVKEDFQ
IFDAQNDTDSKVNSLKTQEKEVRNITENAKAKMTEIKVGNKDNDKKTVKGVQNELDDIGK
LLSKAVDEVNKVVDVIPGLKSSVYELNLKRQELDETIKNNITNSIEYIKFLIQNAHYVAN
VMPLAMTFSNTSELVLNSPQAAVDPSVYNEISLVFKTSADNGLLFFIGNQQEPDKHGFLA
MEIVNLKLNFHFRLNSGSTRTLISKKLLAKDIFYSLNVKRSFGDAVLIVKEFSITQVLPS
EEDKMSSFVELPILSLEKNDLLVGGLPEGVKASSSLKSRTFQGCIDKLVFSNQLLGLWNW
KSARNVYECKYQRESSKGQYMLNGDGFLQFTGKDMELSRVKISFATIEEDGLIMLAINPP
DRNFYSLEIKNGYVFSKFDFGSGLKELNHTVFGKLNDGQIQNLTILTKAKTQVVYGKVID
PFTYPKNPNLASTSIFLGGVPMRTYMPIEGLTTKGFVGYIGALKLRASDLNNATTYSNVT
DSVEPLFGHTASFPSTEANMEVTGCTFQTTFSIGFSFQTYQSTANLLYTASKENHLRVFL
EDNQVNVEIKIGETVKSLVVEVSSGVSDGVWHTVSLYFEKDSSTVYLGIDKIYTTAIFDA
NVEFNFGEKIIIGRNYQSMIGFLGNFRQLYCDLKEIDMMGGQLFNGARIDSLLFDPPLPL
VSPVQLKTTDGSSLVTQYQSTTASAKNTELVKETISNSLSDGNTSNPPSITESPHSTTET
TLLTTKLFTSSISPFEKTSSSISETAKTTLKSSTNVKAVESTAASSPVIDTTILTTTPFI
DTTILTTTPLVDTTISTTTPLVDTTTLPSTTSNKVTTISSTLLETSSTTITTTTAAAVES
TLPTSTEALTTENDDVVTTTNLVSSIVEEKCMPSFEVYPDAVAFGMEAESYVEFSVQLAI
LSQRSEFEFYFYTVEPNSLLLTVNMKDQDYEAIFMKDGKVNYLFNAGAGPVTITSDEAYN
DGKWHKVYQKREKAICKPFYLLLTLYFNVFHEKIHSAKNEYK
Download sequence
Identical sequences gi|449677846|ref|XP_002170373.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]