SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449678421|ref|XP_002155280.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449678421|ref|XP_002155280.2|
Domain Number 1 Region: 178-433
Classification Level Classification E-value
Superfamily YWTD domain 9.42e-51
Family YWTD domain 0.00000494
Further Details:      
 
Domain Number 2 Region: 482-747
Classification Level Classification E-value
Superfamily YWTD domain 3.79e-48
Family YWTD domain 0.0000104
Further Details:      
 
Domain Number 3 Region: 1-130
Classification Level Classification E-value
Superfamily YWTD domain 4.84e-23
Family YWTD domain 0.0001
Further Details:      
 
Domain Number 4 Region: 437-485
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000728
Family EGF-type module 0.023
Further Details:      
 
Domain Number 5 Region: 141-180
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000718
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|449678421|ref|XP_002155280.2|
Sequence length 748
Comment PREDICTED: low-density lipoprotein receptor-related protein 6-like, partial [Hydra magnipapillata]
Sequence
MFWTDWGKQPRVERADMDGNNRLILRKTEIIWPNGLTLDLATKKIYFADARLDIIVSMNY
DGLNQETILKQNILKHPFGLSVFEDYVYFSEWTPSSIRRANRISGGQKYFFNASLVRPMA
IQVVHPARQPINNFFINYCLSHKCSHLCVLRPLGYNCKCPYGMELADAYTCIDIKEVLIY
ARRTEIRGISLNSSDAVDKIIPIMGAQNAIGIDFHFQQKYIYWTDVTKDSISRIFLNGTG
REDIIPSGLPAPDGIAIDWIADILYWTDADTDKIEVSRLDGKFRKVIVSKELSQPRAIVL
HPVKGKMVWTDWGSKNIESASLDGTNRLVLVKEGIGYPNGVAIDYETDRIYWCDALYDKI
ESIFLDGSDRKAVAIKGKYTISHPFGISVFNGDLYWTDWSRRSISRLNMTSGKVTEMRTN
LLSLMGLKIYHKDQQKGTNPCAQGKNICSHLCFATNESFTCGCATGFELHQNNKSCISSK
SFLLYSTTTEIRATPFNEQESDSIAPILGLKSSYAIDFLYKTGTIYIADDMERAIFKVQK
DGNKLEKIITTGLERPQGIAVDWVAENIYWSDAGSNLIEVSRLNGSHRIVLINNGIENPR
ALAVYPSKAFIYWTDWDNKAPKIERSNLDGSNRIVLVNTTIMKSIGENIGWPNGLTIDYD
TDTIYWVDAKFDMIMTMNIHGENIKRLNISAHLPHMYAITVYKDNLYWTDWNEKSIFKVS
KTGELVNVLRGKIENIRDIHAYDESRQT
Download sequence
Identical sequences gi|449678421|ref|XP_002155280.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]