SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449678423|ref|XP_004209085.1| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449678423|ref|XP_004209085.1|
Domain Number 1 Region: 335-588
Classification Level Classification E-value
Superfamily YWTD domain 2.88e-48
Family YWTD domain 0.00000658
Further Details:      
 
Domain Number 2 Region: 640-903
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-43
Family YWTD domain 0.00000547
Further Details:      
 
Domain Number 3 Region: 1373-1461
Classification Level Classification E-value
Superfamily YWTD domain 7.32e-16
Family YWTD domain 0.00029
Further Details:      
 
Domain Number 4 Region: 211-318,583-636
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000863
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 5 Region: 28-65
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000916
Family LDL receptor-like module 0.00088
Further Details:      
 
Domain Number 6 Region: 1194-1234
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000641
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 7 Region: 156-192
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000223
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 8 Region: 991-1029
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000131
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 9 Region: 1032-1069
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000196
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 10 Region: 112-150
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000327
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 11 Region: 72-109
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000144
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 12 Region: 1093-1119
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000262
Family LDL receptor-like module 0.0029
Further Details:      
 
Domain Number 13 Region: 1164-1196
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000995
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 14 Region: 1241-1276
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000838
Family LDL receptor-like module 0.0035
Further Details:      
 
Domain Number 15 Region: 953-988
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000537
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 16 Region: 906-949
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000743
Family EGF-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|449678423|ref|XP_004209085.1|
Sequence length 1463
Comment PREDICTED: low-density lipoprotein receptor-related protein 2-like [Hydra magnipapillata]
Sequence
MKVLLIYSLTAFLLIHVIAALPDVSSKNTTCASNQFQCTSGSCIPLKWRCDSRRDCNDKS
DELNCPESCDPASYFLCNSTVLPKCIPLKFKCDYERDCYDGSDEQNCLSKKCPDENEFMC
STTKKCIPSSWKCDGQFECDDLSDETNCTYYKTKPPFCNPENQFICNDGQCINNKWYCDG
YPDCFDKSDEPSNCNKKKCAENEYSCKLNQKCIPNAFLCDEKEDCDKNSNQANSDDENPS
MCYQSKCENKCEYKCQKQPNGVGICLCPSLYKLSPDNHTCTIVNQCDNNVCSQLCKMVGN
DFQCGCFPGHVLENKTDCRYIDSGDIELIYVDIKVIKRYNLRTGLHTSLVTSMTRGVALD
YDSNSSKLFYTDVTENLIKSVYLHGDSKTINEVNLVKTGLAVPDGIAVDWITKNVYFAES
SAKSIDVVSYDGKMRAPLISDGLVSPRGLAVDPKKGYLFITDWGGVAKVLRSQMDGTNLQ
VLATENGGWPNGITIDYSMEIVYWIDARFDYIDSMNYNGTQRRTVIKGKQYVAHPFAITV
FEDYLYFTDWMKKGIVKVHKQKGSEDYSIILGNLSRPMDIQVLTTGRQFYTPNPCISAKN
KSRFCQHLCVIKSQYEFACLCKYRYRLKDDGYSCEFVDTFLIFARSWEVRGISLDSTYSY
DVTIPILGLNSAVGVDFDTLEEYIYFSDVKLDKIGRVYIGNDSGGDIEWVVSEHLENTDG
VAVDWVGRNLYWTNYKVKGGSEISVSKLDGKYQKTLLQEEIYKPRAIVVHPSMGYLFYTD
WFAPAKIGRANLDGTNHVILVNLTDLIWPNGLALDYDENKVYWTDAKIDRIESMDFDGRN
RVVVIANTQHSFGLALDDTYIYWTDWLSKEILRAKKNNISDVNVLRNSYSGLMEIQIYNR
KVQKGNNICAVAKCEQLCLLRPNNSYICACGFNYTLMKDGKSCVAGNETWKEYSCREGYF
YCDNLCFRNSSKCDGYKDCTNGEDEDSCDNMVCDESKIKCEEDNLCIPLTWRCDREKDCS
KGSDEKNCTYPIYCNSTTQFACQTGGCLELIHKCDGEFDCFDKSDEINCALKKCNSITQF
QCWSSGIYVSGPPSGPCIPLEWVQDGVNDCLDGSDEAGYITDCYNSSLSSNSSSSSNSSY
SSNNCTFNNGSVDIVCDNCLLDVEFRCVKSQKCISNRFLCDYIKDCDDASDEINCNYTEC
TAGHFQCQNKHCILLSHRCDNTDDCGDNSDEVSCGSLVEKTCKDTEWKCQNSTKCIPIAS
VCNEVNDCPLSDDEGPLCKLNGWVALFVLISYWAYSAAVDQDTYYLMIHRLVKISMSVLL
IMVCVVSFAMIPKGLISANVQKDTFYVKEVSHVQLVVQVQVLFSQMVNQYVRSTQQQRLY
WSDVGTDKIERMFLNGSGREVIISQGMNSPEGIAIDWVAENIYWSDMRLDTIEVARLDGT
MRSVLISYDIDAPRALAVDPRYG
Download sequence
Identical sequences gi|449678423|ref|XP_004209085.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]