SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449678443|ref|XP_002155879.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449678443|ref|XP_002155879.2|
Domain Number 1 Region: 426-612
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.47e-41
Family Ankyrin repeat 0.0000556
Further Details:      
 
Domain Number 2 Region: 148-176
Classification Level Classification E-value
Superfamily Notch domain 0.0000000798
Family Notch domain 0.0027
Further Details:      
 
Domain Number 3 Region: 18-58
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000181
Family EGF-type module 0.035
Further Details:      
 
Domain Number 4 Region: 103-134
Classification Level Classification E-value
Superfamily Notch domain 0.00000196
Family Notch domain 0.0024
Further Details:      
 
Weak hits

Sequence:  gi|449678443|ref|XP_002155879.2|
Domain Number - Region: 185-213
Classification Level Classification E-value
Superfamily Notch domain 0.000379
Family Notch domain 0.0031
Further Details:      
 
Domain Number - Region: 59-96
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000419
Family EGF-type module 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|449678443|ref|XP_002155879.2|
Sequence length 728
Comment PREDICTED: neurogenic locus notch homolog protein 3-like [Hydra magnipapillata]
Sequence
MEVNDKEQSIEENIDIADVDVNECTKIFCGLHGRCESTKNGYECVCNSSYTGPFCDKKIT
YCTNTSCPHGTCIEKDNGFSCKCNDENFIGENCSISLLSNVTKCPFEECHSKFDGGVCNP
KCDNPQCNWDGTDCTLGVDPWIQCKSQKNQCWKHFGNGVCDRECNNMHCLFDGNDCRPKI
DECPSDCAKKFGNRICDRHCDTVACGHDNKECSMNTPPKLVQGFLVIKLRSGRSEFEANQ
VQLLRNLSIILNTILTIVTVETSSKFRRSSSDSAFTTITLKMDNSLCTELCFDSPKVAAS
YLGARAQKKNLDLVFPIYSVSDSKLSPNTSSITHSVIIVTIITLVLVIVVVGGKKMRFRL
WKFNQDRPNVSERGEADGGEEIGLSPPHSSFGVDDYSLEGYSSAKKLKLSEEAETEVLVD
TRRHFCQNHLLHQAIIVGNIEEVIALLDRGFDANGVDDTGVSPLQKCVLRNNFDAFRLLL
RRSNIDHQCQLGKTALMMSCYYKNCCMLDELLAVGARVTLTDVNGHTALHHAALAGNANA
IHILHKNNAKVDVQDILGQSPLFLAVVSISIDAVSALLAHYANKNLGDNMDRTPLMIAKE
IKHLQLVSLLSDWDGSPQSPISPTNIKVYTNGSKKRKRKDSWGRGVGCTSNSVSFSNPPR
FHYDDRSARNQFLYQRTSTDDAINPFPTPPSVTIYSPSYKDACSPNFGPNIYELPSPPES
WSTSFSSP
Download sequence
Identical sequences gi|449678443|ref|XP_002155879.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]