SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449678566|ref|XP_002165367.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449678566|ref|XP_002165367.2|
Domain Number 1 Region: 2-148
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.11e-54
Family N-terminal domain of xrcc1 0.0000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|449678566|ref|XP_002165367.2|
Sequence length 292
Comment PREDICTED: DNA repair protein XRCC1-like, partial [Hydra magnipapillata]
Sequence
MTLNIKHVVSFSSEDPSFPAENLLKSENYYKWKCASGTERQATVILQLEKVSKIHSIAIG
NCGSAFIEVLVGRSSWSANNEFQVLIAASTFMSPSESKSGKELTRVRIFGNESIIKSVGQ
EKWDQVKIVCTQPYCQTDGYGLSFIRIHPPPDTNIQLSDSTNNSKEIVMGNFRLKSSSDD
ENSLALTAGSFFQKRKISESQDQISPKVSMAVAARTGLSSQKPLVFASSSTDNSSKTINI
SANRRNEVAASLLNSSNTEKSKSIFPKMKNESSKRNVMDIESAKRKSIEESE
Download sequence
Identical sequences gi|449678566|ref|XP_002165367.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]