SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449679036|ref|XP_002161856.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449679036|ref|XP_002161856.2|
Domain Number 1 Region: 1310-1433
Classification Level Classification E-value
Superfamily Cadherin-like 3e-31
Family Cadherin 0.00076
Further Details:      
 
Domain Number 2 Region: 1016-1135
Classification Level Classification E-value
Superfamily Cadherin-like 6.57e-28
Family Cadherin 0.00099
Further Details:      
 
Domain Number 3 Region: 236-351
Classification Level Classification E-value
Superfamily Cadherin-like 4.14e-27
Family Cadherin 0.0008
Further Details:      
 
Domain Number 4 Region: 1907-2014
Classification Level Classification E-value
Superfamily Cadherin-like 2e-26
Family Cadherin 0.00072
Further Details:      
 
Domain Number 5 Region: 445-564
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-26
Family Cadherin 0.001
Further Details:      
 
Domain Number 6 Region: 912-1034
Classification Level Classification E-value
Superfamily Cadherin-like 8.42e-25
Family Cadherin 0.0018
Further Details:      
 
Domain Number 7 Region: 548-663
Classification Level Classification E-value
Superfamily Cadherin-like 5.71e-24
Family Cadherin 0.00059
Further Details:      
 
Domain Number 8 Region: 1618-1720
Classification Level Classification E-value
Superfamily Cadherin-like 7.99e-23
Family Cadherin 0.0016
Further Details:      
 
Domain Number 9 Region: 1519-1625
Classification Level Classification E-value
Superfamily Cadherin-like 5.57e-22
Family Cadherin 0.0015
Further Details:      
 
Domain Number 10 Region: 769-899
Classification Level Classification E-value
Superfamily Cadherin-like 1.21e-19
Family Cadherin 0.0038
Further Details:      
 
Domain Number 11 Region: 1799-1905
Classification Level Classification E-value
Superfamily Cadherin-like 2.86e-19
Family Cadherin 0.0051
Further Details:      
 
Domain Number 12 Region: 1132-1231
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-18
Family Cadherin 0.0015
Further Details:      
 
Domain Number 13 Region: 1419-1517
Classification Level Classification E-value
Superfamily Cadherin-like 3.28e-17
Family Cadherin 0.0017
Further Details:      
 
Domain Number 14 Region: 1225-1322
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-16
Family Cadherin 0.0015
Further Details:      
 
Domain Number 15 Region: 662-735
Classification Level Classification E-value
Superfamily Cadherin-like 4.71e-16
Family Cadherin 0.0026
Further Details:      
 
Domain Number 16 Region: 2207-2287
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000116
Family I set domains 0.014
Further Details:      
 
Domain Number 17 Region: 2002-2101
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000286
Family Cadherin 0.0039
Further Details:      
 
Domain Number 18 Region: 2134-2213
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000698
Family I set domains 0.044
Further Details:      
 
Domain Number 19 Region: 357-457
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000714
Family Cadherin 0.0048
Further Details:      
 
Domain Number 20 Region: 148-248
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000157
Family Cadherin 0.0039
Further Details:      
 
Domain Number 21 Region: 1715-1794
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000271
Family Cadherin 0.0022
Further Details:      
 
Domain Number 22 Region: 733-781
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000157
Family Cadherin 0.01
Further Details:      
 
Domain Number 23 Region: 2353-2397
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000179
Family EGF-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|449679036|ref|XP_002161856.2|
Sequence length 2695
Comment PREDICTED: protocadherin Fat 4-like [Hydra magnipapillata]
Sequence
MKEDNNIMKEDNNIMKEDNNIMKEDNNVMKEEQTKVLKGALLSKCDNAETAVDGGSFKYF
QTKFTGKNQRISVELVDKQGLSFIYVSIKLRNPGPLSEEKDVNKSESNISPRIISIDLPS
TGETIIYIAVQGQKDYNVFELSIWESLFITDQISVNISENEIAGHQVLVVQTLSHPESFN
YIIKDGLNSGDFRIDNNGKITTNKSLDRESISSYKLSVIAEDKNDKCHKGLISIVINVDD
KNDNKPEFEKQEYKVELREDTPLNQFVIQVQATDKDTGKNAELTYELSGSNQDIFKIENK
TGIIKTNKALDYESKSSYTIGLVVFDSGANVLVGNASLIVTVTDVNEPPEFVNCKIPRSC
NFRINENQPENTIVEKNLTAIDPDTTPCSLIYSIVSLDKQYFKIIGNTIQTRMPLDREAK
ESYSLEVSVKDCGTPPLHAFTIINVVLNDLNDNYPKFSESSYKCFAKEDLPKNATLCAVT
ANDIDAGINAKIIFSISSSNEGIRINRNNGILTLDNSLDRETKPIIELVITAIDQGTPSL
RSSVNLTIVVVDVNDNAPKFIGNRNLSIDENVKTRTVVAKLGAEDFDEGLNAQVRFLITS
GNTDDMFTINNQGELVTQKQPDREKIDFYSLNITVHDLGDPSLSNTAVYTIQINDLNDNS
PIIATDMDLGINKEITYGILGGNQENVFFLDPNIGSLTLITTLKFRKQKKYTLNVAATDK
GSPSRSSETVIEITVEGFIDYEVTPSFSFTVYVQDGGTPSFKANASVFIQIVDLNDNAPI
MANQTIYVVENEVKEKKIFVLNGVDKDSGSNSIIDYSLIDSKLPFKIQDDQLRVNGILDR
ENISKYSLDIILTDRGIPPQKSISTIIVIINDENDNDPKFGQSSYDCSVRENSPVGTFVC
SVEAKSTVTLSVTILDENDNKPAFSLVSYNYSFIEEQNAGTEVGKVFVTDEDIGSNKEIV
FGVIGTDRFWIDSQDNGIGIIKAKKMNREEKDFYQFIIRASDKGTPSLSSFVNVAVTITD
INDNVPLIEEKMYQRNIKETVSNGTFVLKITASDLDIGKNGQFVYEIKSSPNSDHFFINS
NTGVITTAAALDYETVASYILNIETIDQGSPPLSDSAVVNISIINEDHTAPKFEQVKGVS
IYEDLGVNQPIMQFKATDADGSNLTYKIIGGNDEDTFQINQVTGLLSLKKSLDRERKDFY
NISVEASNEKKTEVVYLPVGVLDVNDNYPIFNHESYSGNVEEESDDFTRAIVTVIATDKD
LNLNAEIEYKIVSAHNNTFEVDSKLETYIIEVAAVDKGIPSLRTSVFITINVADINDNYP
KFENDVYNISVKENLGAGHFLIQLRAFDIDKNENGTVAYSISADCKSFFSINESTGLLYA
LINFDREEKDSYTIKVKAFDRGIPSKSSETLVNIIVLDVNDNAPVIQTKTLPAVNESVSI
GTNLFQILADDSDIGINKVLVFSITPDIFRIDNNGNIFLNRPLDRELVSQHNVLVKVEDT
GTPRLHTSMNYIINVTDDNDNAPVFLNTSYYVDLEENFQSKKLLFKAHANDIDIGINSQI
AYSILNNKEIFLINASTGDIYTMKAVDYETIQSFVLNISASDWKFTTFATVVVTIINLND
NYPQFEMVEYFASILENATRNSLVVNVNANDLDAFGKLSYILSNTTDLPFIIESETGSIK
VSNNLDREKIGSYSFKVIVFDNGNPKLHNETNIVVKILDVNDNRPKFKSNSEVISLKENK
PVGTSISLLSPTASDEDIEENAILRYEAVQNSYDLYVNNVTGEIKTLRVFDREFQSNEND
NAPMWITNPSPNILEDYPINTQIFVMEASDNDLGQNADISYYIKDDSMFQISLSDWINYR
FDNLLSLKKSLDRETKDFYNLTIFARDNGDIPLENFITVNITVLDVNDNYPIFNEDELHA
EIKENSKGINELVKLQATDQDIGSNAQILYSLQHDLFSVNSTTGQVIVLRALDREEISQY
NITVVARDNGNPSLHTEALLIVDVLDMDDNCPVFTSSFYKETILENLPYGTSILQVTATD
KDIGANADLTMASREHDRGIEFSIMRIDQKVVSNQVQNYVMIGVSDKGDKPLSSNATFIV
INTVTCDAMYFSITEVGLLKVSSLCSVQNQNSQSEIVVLVNNSVSLSCIATGNSPVIYRW
SKDGSLVSGWSNDGNISLPSVKPDYEGSYACIASSKPGVIQSSVTKLLIHEKPSILKQPT
NVVVNEKETAILTVKATATPRPTYQWFKNDLPIKHATQDEFVLESTIPADSATYFCNITN
NQGQVQSEKVKINVVNRESVVELNIKILKPNIKNLCFDFFLEDFEEQAKVILNRPLYVTN
FRNTENIKKLCNRTACSKNPCRNKGLCEIIDTGFQCVCTDSWQGQTCEENNEVCVPFESN
SETVNQTFRCISKSNIITLISKPIMNWSLPTQYDLELSLNRIVKAINMSVPADRKRKRKD
ISVMDFGHCIVHVTDHVLKNDESKVFFILDCTISKLGSNKSAIFFSPNVVKGFCLQLLSS
DDTFSQCGQLDGFMHKPVVPKMTPLNANVHIVIKDGNEKVLPADKAIQIMKENDFAYHLE
KYNYKVISVRSAYDKPIQEKKGRTLVIAISVTCAFVIIAVVFVSVYRRRCSKTNDKNNQS
SIMFQRSMMVHDASTSNLIPDYTSKTNKAYDEKNDDDNDAAFMFEVPTDLISKKK
Download sequence
Identical sequences gi|449679036|ref|XP_002161856.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]