SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449679742|ref|XP_002163707.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449679742|ref|XP_002163707.2|
Domain Number 1 Region: 177-238
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000347
Family Complement control module/SCR domain 0.0029
Further Details:      
 
Domain Number 2 Region: 111-182
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000017
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 3 Region: 18-82
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000815
Family Complement control module/SCR domain 0.0029
Further Details:      
 
Weak hits

Sequence:  gi|449679742|ref|XP_002163707.2|
Domain Number - Region: 73-114
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000358
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|449679742|ref|XP_002163707.2|
Sequence length 253
Comment PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1-like [Hydra magnipapillata]
Sequence
MSKLKFLNNHFFPECDDCQQPHLPVNSFQVNNKSAVYKDKSFLYYKCEDGYSFGADSLQK
IQCVGGKWDPRILPKCIDHCNNVCGNHGQCKKYENDEYRCQCDHFYDGVNCTERVCEAPI
LYAHGIFKLITGKVQSNKYSLSSSIQFSCVAGYKINKGNTQSHCTRDGWVPEYVPECEEI
ECENIYKSDSLVQYTPMKTNYHIGSVVQFTCSNTFLLGSATSTCQIDGDWSVPWPTCKCR
YLFRIFHTKIFIQ
Download sequence
Identical sequences gi|449679742|ref|XP_002163707.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]