SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449681730|ref|XP_004209908.1| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449681730|ref|XP_004209908.1|
Domain Number 1 Region: 209-342
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000518
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 2 Region: 72-193
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000188
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 3 Region: 362-407
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000251
Family EGF-type module 0.026
Further Details:      
 
Domain Number 4 Region: 11-51
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000258
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|449681730|ref|XP_004209908.1|
Sequence length 432
Comment PREDICTED: fibrillin-1-like, partial [Hydra magnipapillata]
Sequence
ISEIEYLFLVIDINKCALSTKNNCSANAICNNLVGGYNCTCKSGFNTSNGGIESLSDQCL
DINECVFSNKNNCSSNATCNNLVGGYKCTCKSGFNTSNGQIELLTDQCLDINECALSNKN
NCSVNATCNNLVGGYNCTCKSGFNTTNGGIELLSNQCLDINECELSTKNNCSSNAICNNS
IGGYNCLCKSGFNTTKGEIESLSELCVGNQCIVANPCNWSNSLCLYFNGSYECKCKPGWV
LGSNNISCVDFDECSQRPCGDLNCVNKIGSYECQCLFGTIFNSSSMMCEVVNECQGMINE
YICNPANGFCVSVNFPLQPKCVCPKGYTISLEKKCEGTANSCAVANSCSGTNSCAGANSC
ADVNECLTWCLGPNAKCENYAGGYQCTCAAGYSFNYGIHQCTRIKNETSDKLYKVMTVLK
KRGCRSLRQKCG
Download sequence
Identical sequences gi|449681730|ref|XP_004209908.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]