SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449681844|ref|XP_004209935.1| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449681844|ref|XP_004209935.1|
Domain Number 1 Region: 256-296
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000247
Family EGF-type module 0.0067
Further Details:      
 
Domain Number 2 Region: 412-459
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000255
Family EGF-type module 0.01
Further Details:      
 
Domain Number 3 Region: 370-413
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000383
Family EGF-type module 0.044
Further Details:      
 
Weak hits

Sequence:  gi|449681844|ref|XP_004209935.1|
Domain Number - Region: 297-328
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00559
Family EGF-type module 0.03
Further Details:      
 
Domain Number - Region: 188-225
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0786
Family EGF-type module 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|449681844|ref|XP_004209935.1|
Sequence length 686
Comment PREDICTED: delta-like protein C-like [Hydra magnipapillata]
Sequence
MAKLEYLCWVVIALSQFQITKSIGNIEIHIEYFKIQKDYLNCADTCLQHASICLSNINHN
SNCDIGYIEQEYKQYNFNLSFINFTLPLVVPVKDLYMISFEVNQQTSNNNSALLKKYSTY
ISFTPHNKWVAVRQQFIGFYIRTTCDLPESANATFWCDHPGHYYGYNANNVKLCNKGWEG
RNCDKNNTICIPRDNYRCRNMQYKICNPGWTGINCEVSTYKKLCKPRDDHTGHYGCSYEG
NKVCNVGWEGENCLKNIDDCLSNPCLNNGSCIDLHANFECVCPGKYGGKQCEIDFRNEPC
KNKGIMLPDNTCKCRFGYKGNKCEICIPYHLCVDHGTCKNHDTCNGLCIPGGWVGQFCEI
EQDGCSHNRGKKFCSSKGICVNDQKVSVSGQAWKCLCYEGWVGKHCEIKIHICNKRSPCQ
NGGTCLKSGKHFNDDQIYNCRCPLGFSGKNCEIEINVCEKLSPCQNGGTCLNIGKHFNDN
LIYECQLTENCAKVIFFFNVRMLPKGILLEELCQQFYIYKRVQSLFISNEVSLQCSHVRF
NSSLDQLIINIYSKKKTIQLSLEIAKYKHTLVEQFENFKWHAPPTLVLFFRSVAYTSIEK
PSTMHSFLKEEGYFFPLVGCMVVCVLVLFVCLYMRLYKKMTVKKVYLSDTTTVIEHNKLE
ENTLLVNKENLKKGIFKTISRKSELL
Download sequence
Identical sequences gi|449681844|ref|XP_004209935.1| XP_004209935.1.79663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]