SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449682193|ref|XP_004210018.1| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449682193|ref|XP_004210018.1|
Domain Number 1 Region: 576-811
Classification Level Classification E-value
Superfamily YWTD domain 3.92e-43
Family YWTD domain 0.000012
Further Details:      
 
Domain Number 2 Region: 25-63
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000969
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 3 Region: 476-520
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000168
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 4 Region: 284-321
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000209
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 5 Region: 243-279
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000113
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 6 Region: 75-108
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 7 Region: 384-426
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000223
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 8 Region: 200-237
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000654
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 9 Region: 159-205
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000838
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 10 Region: 122-155
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000223
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 11 Region: 432-470
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000432
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 12 Region: 506-550
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000019
Family EGF-type module 0.0048
Further Details:      
 
Domain Number 13 Region: 876-910
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000497
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 14 Region: 353-385
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000301
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 15 Region: 817-859
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000726
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|449682193|ref|XP_004210018.1|
Sequence length 1054
Comment PREDICTED: low-density lipoprotein receptor-related protein 1B-like [Hydra magnipapillata]
Sequence
MKGSKTLLSYILFIIGLQWKSVAALPACHDDEFKCKNGTCLSLTSMCDNVDDCGDNSDEE
RCVAEKNNKVCPIENGSTQFRCKNNLCVSVAKMCDGYDDCGDSSDESPTGGAKCVSIKCR
NSDDFRCETNPVCISRYYRCDGTFECEDHSDEANCESVKCSVDEFQCLNKMRCISNSLRC
DFRYDCDDKSDEVKCNLHNTTCPNGSFSCKGSNHCLDNSLKCNGVKNCPDNSDELNCPKS
TEKCANDEFKCLSNGKCIKKAYRCDTVDDCSDGSDEMDCLNSDHRCETDQFRCSTGHCIH
KYLQCDGESDCIDSSDELNCHVEKSQPKVGSLVMSTGNLTTSETNMQNDSCVLFCPTNKE
CLSRAFLCDNENDCPDGYDELSSTCESISCNKDEFKCANGKCEKKKQVCDGIDDCGDNSD
EADELCSPTAAPVSCNNDSYQCKNESKCIPMTSVCNSINDCANGDDEDNLCDVKECDNEN
GGCSYKCKELKLGYECLCPQGFQLDSDKKSCIDIDECKEGWNVSKCSQICTNLNGTYKCS
CHNGFNLVNKKCRANGSVVDLIFANELDVRILQSNSQHYRKFADAYNANAVAVDVLTEMI
YWSDIVKGTISCASRSNFNPKVIISGLKKPRSLAVDWIGRKLYWIDTAFNNISVSNLDGS
FPKTIVEGNGFEEFSGLAIHPFEGYLFWTDVATNGKVVRSNLLGTSQTTLASDLGMPMGI
TVDIESNKVYWSDMHLHHICSVSLDGSAFNRILKNIESPLSIAVFEDEVYWTSKVGKKIY
RANKFDGTEKSEYNASFLSPMDVVVYHSSAQFYSPHPCNINNGNCSHLCLVQNLTNGICA
CPDGMNIDINMKSCVSVVKTQVDKDIFQNKSDPISVCNGYQCHSSSKCIEKLFVCDGVTH
CPEHDDETSCKSDYSNVSEINNEVTTATSGNNKSFIIGAALGSIFLLLVFFVVFIYLLRK
KRSRFDLSMVYETESDIVYGKDGYDNNLQLVIGNQIKETKQSWSSKQKTIEVAAYDEAKT
PLTDKNKDENCFEDSSSGEVCFDDDRQPIIANIV
Download sequence
Identical sequences gi|449682193|ref|XP_004210018.1| XP_004210018.1.79663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]