SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449683165|ref|XP_004210285.1| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449683165|ref|XP_004210285.1|
Domain Number 1 Region: 20-315
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.35e-33
Family Ankyrin repeat 0.0023
Further Details:      
 
Domain Number 2 Region: 329-369
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000157
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|449683165|ref|XP_004210285.1|
Sequence length 397
Comment PREDICTED: putative ankyrin repeat protein R873-like [Hydra magnipapillata]
Sequence
MFSYEFDFTVKSSWYKSTEDAFENAAKNGNLEIIKHLHELGYKGTEWAIELGYKGTEYAI
DIAAMNGHLEVLKYLHELGYKGTEWAIDDAAENGHHEVLKYLHELRYKKGNKVDFAASIG
RNDLIKLLNQLGEKGTKDVQKYLHSLGYKGIKDAIDNAVKNSHLEVVKYLIELGYECYEW
IIHVAVENGHLEVVKYLHSIGYRVEEWEITSAAKYGHLEILKYLHELGYRGTEYAIYHAV
HKDHLEVVKYLIEKGYRGAEDSIDFAASIGRIEIVKYLHELGYRGTENAINEAAENGHLE
VVKYLYSMGYRGTEYASSNAAENDTNSLCSTKGCYSSNYCYVVSGNAVCSCPYGYYLQPD
KRTCLVGMNFVVMVFDVGVILVGLLIMGKAPSSNNSL
Download sequence
Identical sequences gi|449683165|ref|XP_004210285.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]