SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449683383|ref|XP_002154154.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449683383|ref|XP_002154154.2|
Domain Number 1 Region: 57-173
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000008
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 2 Region: 144-274
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000104
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 3 Region: 298-412
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000667
Family Clostridium neurotoxins, the second last domain 0.067
Further Details:      
 
Weak hits

Sequence:  gi|449683383|ref|XP_002154154.2|
Domain Number - Region: 1-36
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00639
Family EGF-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|449683383|ref|XP_002154154.2|
Sequence length 634
Comment PREDICTED: uncharacterized protein LOC100202622, partial [Hydra magnipapillata]
Sequence
INYCADGNFTCSKKSTCTYENIPGRYKCYCNSNYLNGDELISPCIDLDECALKKDNCDRV
NGFCNNTDGSFSCGCNQGFYQDPSSLKCIDIDECFNGKACDLRYSICINTVGSFTCNCKP
GYEKIPNTLSPTCRDVNECCPVNNCYSDSSVVATCTNSVGSFGCKCPPGFWGNGYPLNVT
LPYNGTGCNDIDECFNSPCLDTQQCINTPGSFMCLCKPGFYLEKKLKLCLDKNECHTKNI
CGDTTCVNTGGSFVCECPESSIGINLNGVIKCQDYLSWSSEQMLVGGKKAATITVLKKTF
TINFKVKISSYFNGNIIKITDNSGNYIDVSVKGSNMLFYVFGNQAMANITLNQWLSVAIS
QFNGSFYISFNQFNVAKFDSTFNGPNDYANMNIIMSDPAANGSISELKIANGDASIWGKW
QMQSRCQPECGNGTATFVRTCNSPACLFMNQSKTEFCFIMNCNQGFPVLKDGSCNGFVDF
KNNLDFTLFYQTFKLVDVQMILEYVKKFSAVQLPFVCNDTFNRNILDDINAAYNYSADGL
SSLLNVKNILRNYISCQPNVLKNLPGSSLIMAMFEKYDNIVERYFAVSNLFTVIKNKQRE
VKQKVDMCSKQGLVNILHDNANANKYNNIMLSSS
Download sequence
Identical sequences gi|449683383|ref|XP_002154154.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]