SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449683703|ref|XP_002157633.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449683703|ref|XP_002157633.2|
Domain Number 1 Region: 100-353
Classification Level Classification E-value
Superfamily vWA-like 1.5e-64
Family Integrin A (or I) domain 0.00000143
Further Details:      
 
Domain Number 2 Region: 368-436
Classification Level Classification E-value
Superfamily Integrin domains 0.0000000000162
Family Integrin domains 0.003
Further Details:      
 
Domain Number 3 Region: 608-682
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.00000000112
Family Integrin beta tail domain 0.003
Further Details:      
 
Domain Number 4 Region: 521-560
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000649
Family Integrin beta EGF-like domains 0.0037
Further Details:      
 
Domain Number 5 Region: 10-48
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000732
Family Plexin repeat 0.0036
Further Details:      
 
Weak hits

Sequence:  gi|449683703|ref|XP_002157633.2|
Domain Number - Region: 57-122
Classification Level Classification E-value
Superfamily Integrin domains 0.000889
Family Integrin domains 0.0048
Further Details:      
 
Domain Number - Region: 575-602
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00335
Family Integrin beta EGF-like domains 0.053
Further Details:      
 
Domain Number - Region: 486-521
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00558
Family Integrin beta EGF-like domains 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|449683703|ref|XP_002157633.2|
Sequence length 762
Comment PREDICTED: integrin beta-2-like [Hydra magnipapillata]
Sequence
MSDTGYQGKKCKERSTCSECMLASGECYWCADPGFPYDRCNLKPILQGDQNCKLISIEDN
KVVSEVNKEFSSTIQVVPQEVSFKLRPFQSQQFKISVKPARDYPVQLYYLMDMSKSMEDD
QEKLKSLGKKIAEEINKITKNYQLAFGSFVDKTVSPFTQVDIINHPCDLDEKFGKKGPCD
PTFGYRHNFNFDSNATKFEEAVAQQKISGNLDTPEGGFDGLMQVSVCDTILGWKNMDQAR
RIVIFVTDASPHIAGDGKIGGITAPNDGLCHLLDKDTYKIYDKSNEMDYPSISQLKVKMK
QNKVVPILAVTSDVFPVYQKLAEQWKDTGAAIGKLEFDSSNIVDLIRDSYKKIATTVRLI
DDSNRDRFTVRYKGSCSSPVDNECQNVQIENQVDFTVTITALDCKSAKNDSFKITIPGFG
DVKVNIEMICDCPCERDAGIPNADICNKNGTSKCGICYCNPGRYGVNCDCDNKAQADTSL
CKIANSTDDRVCSGFGICVCGQCECIKRSAPDERIYGKYCQCNNFGCDRYQGKICGGPER
GVCDCQECKCKEAFQGANCGAINCTIGAINCRKDNQVCSNNGVCACDTCVCSFGYKGKYC
ENCVSCPGKCANVKDCVFCQAFKKGKDEVCSKCNLNIRIVNKTEEKCSYLDDDNCYVIFS
FEDNEFAGTSNETILVQKERKCIVIVPTDPPILAIVLGTIGGIVLLGLILLLLWKLLITA
YDNYEYQRFERERMKSQWENAENPIYKPSKQQFQNPTYAGNN
Download sequence
Identical sequences gi|449683703|ref|XP_002157633.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]