SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449683952|ref|XP_004210504.1| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449683952|ref|XP_004210504.1|
Domain Number 1 Region: 744-880
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000596
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 2 Region: 704-760
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000529
Family EGF-type module 0.032
Further Details:      
 
Weak hits

Sequence:  gi|449683952|ref|XP_004210504.1|
Domain Number - Region: 873-929
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00225
Family EGF-like domain of nidogen-1 0.077
Further Details:      
 
Domain Number - Region: 665-717
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00664
Family EGF-type module 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|449683952|ref|XP_004210504.1|
Sequence length 930
Comment PREDICTED: uncharacterized protein LOC101238128, partial [Hydra magnipapillata]
Sequence
MVFIKVYGVIRNAAVKEIYGDMDTQKCRGQRQNNGSNMSGAYKGAQALMSFAEYASKLKQ
NFPVIFDELLSFLAVRANLTIFSISNLTMRELFEKTVGPYWDSHVSKYLQNNHISLDVVS
VMEQMLLGDLVNKMPRYDLQDFWNVPVKALLYQSSFYLKETGIEDVIIMLKSVYFENQKS
VTFEFQGINISQPYILYIYPYVKNVVIKLQFNQTLRIMKAFEITLSQLAVLSFDSFDKIN
EIMANEVFGKLHKQDSSYYHKEILNILVRIQMYRSSFYQWSLLCNQNSLSHSQEVINYIS
NRCFKQDFSNVGLILYNLSAEYANVFKLLTVEESSILVNRTLLNSNLIPVQNQLAEMIKV
MKIVNTAKSRCIIFLLNDIGLSLNSIIYLTISNILTRVHDLPWSILVKLYEIEEYVAVKA
NFIIFRDLPKLISGENKIQTIDLKFLQLQTIQLILNALSVKINATALSNQYKDISILMSK
FPLTRFAAVFDLSHEYVINSTLTSLTYASFNLNYNDFLENYGVTPSQYSFFDRTTIKDMG
LLLKLEKKDLIFLAINQLIASMKSNIIFFNIMLMTPVKLASSNNKTVNFQLSIPQIVHEI
GNGVVKTLDEFLNFIKRWSTSESAIIILTEKDLNDLGMLLMRPTTEVANMRIVDVVNAIL
DTFGDHCDPQNLYCKKLQVCTKMSENGSRCQCQLGYRFSGPSECSDLNECLYTNVTCHKN
AYCKNTEGSYHCLCKIGYDGDGRFCNNVNECSIGTYNCSNNTFCMDTEGSYKCICNKGFI
ENQFGQCIEIDKCALETYNCHVNGLCIKTSNNYTCQCRNGFKGDGTTSCLDVNECETKSY
NCTANSHCLNTIGSYLCICNEGYFNDNKFCHQCSDTRFTCHKYAECYKQIYNNFYCVCKV
GFIGNGTFCQDIDECKNENICGMGQCKNLI
Download sequence
Identical sequences gi|449683952|ref|XP_004210504.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]