SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449684041|ref|XP_002170661.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449684041|ref|XP_002170661.2|
Domain Number 1 Region: 190-356
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000439
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 2 Region: 161-204
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000101
Family EGF-type module 0.01
Further Details:      
 
Domain Number 3 Region: 76-119
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000175
Family EGF-type module 0.01
Further Details:      
 
Domain Number 4 Region: 131-169
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000735
Family EGF-type module 0.0082
Further Details:      
 
Domain Number 5 Region: 38-80
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000921
Family EGF-type module 0.01
Further Details:      
 
Domain Number 6 Region: 351-387
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000786
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  gi|449684041|ref|XP_002170661.2|
Domain Number - Region: 18-44
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00122
Family EGF-type module 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|449684041|ref|XP_002170661.2|
Sequence length 404
Comment PREDICTED: neurogenic locus Notch protein-like [Hydra magnipapillata]
Sequence
MVLTDKILQVVIYNNFEDTENSGGCSCKPGFGGKNCETNIDDCVLGICNNGTCIDEINSY
KCKCKDGFEGSTCNINIDDCAKKECLNNASCIDGINDYTCVCNPGWIGRTCSQNINDCVI
PCASGQVTDLVCTKSPCENGLCVDLVNNFSCNCFPGFKGRFCDLKINHCAENNCLNGATC
INQLEDYICICPVGYSGKNCSININDCLPDPCSKVGSRKCFDGIASFKCDCKDGFTGTLC
DENINDCDPRKDVNVIEGMDLTSWGLCGQHGVCVDLINSFQCNCSKGFDGKYCQIGDYHC
IFQVKQGIDTYINECSLNPCNNGGSCFEVETDSRFYCVCQPGFSGHTCETDINECLKNDC
CSNSDCVDLVNGYMCKCKNGMKGIDCCSAYYLSIIHWHCYNLHC
Download sequence
Identical sequences gi|449684041|ref|XP_002170661.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]