SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449684735|ref|XP_004210702.1| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449684735|ref|XP_004210702.1|
Domain Number 1 Region: 86-122
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000249
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 2 Region: 45-84
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000647
Family EGF-type module 0.014
Further Details:      
 
Domain Number 3 Region: 121-159
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000237
Family EGF-type module 0.016
Further Details:      
 
Domain Number 4 Region: 435-473
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000125
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 5 Region: 477-517
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000156
Family EGF-type module 0.014
Further Details:      
 
Domain Number 6 Region: 311-347
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000122
Family EGF-type module 0.011
Further Details:      
 
Domain Number 7 Region: 236-270
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000575
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  gi|449684735|ref|XP_004210702.1|
Domain Number - Region: 393-433
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000211
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 268-309
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000671
Family EGF-type module 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|449684735|ref|XP_004210702.1|
Sequence length 1270
Comment PREDICTED: protein eyes shut homolog, partial [Hydra magnipapillata]
Sequence
KGHGKGVPDGIGGCIKRTADRLIGHGKDIPDINYLVEEIKEKCPKVNSCIPNPCLNGAIC
YEKPGLGKFECICEADWRGTICNQPTPCSTFPCLNGGKCVDSADNYKCLCNDGFIGRHCE
IELCSPNPCKNYGKCFQDGKTFKCLCPEWTKGELCEVHVSFILVKIMQSVSIPQAFINGT
LPQHIIIVNANLHGLVSIAKLANVKLAIFMPFVMEKSVFVSKDIQGMDWFAQLETPCAPN
PCENSGICHDEGNGNFHCVCKLGFKPPLCKDTDLCNPNTCNGGVCTLTLDGGFKCTSCPP
GFYGVTCRQNDSCLSNPCQHGGHCRLSSLGNHVCDCVGFWSGEVCEKCSCPSSMNPLVPS
PYCLLTTGQCVCPGHHVWESKQNKCILPKAEIIDPCFSSPCLCGGTCIWDNRVSSEYTCL
CNERCSGPRCEFENACQRDRPCYNGGNCTNLFGGKYKCHCYFGYSGVNCEIAPIKRVSRC
DINVCLNGGICKPLNYGYDCICLPRYTGIHCQVDRCRDCDIHAKCVHGVCKCLPGWVGNG
YECVKEECDSKCVGFQTCISGVCGCLPGYIIVQNICMRERKSTIKALPVSITPRTMSTFD
HMLGTTRKPLTTLYEASVATTVTHQPTIGLPMTYYLSTVSTNLPATTRLPSIEYYDNNTP
SASKQSIKSGNHFSKSINASKHSEITYYYYPINSFDDLRANMKDAGQYGEDLRTNMIEAG
QYGEDSESFNGQINNPLGSEVTQDRKFILDSLHYPNSFLDYPTEQKSTDMSNESLSSFIK
QENMDIAKIRADHLKYVDNDIESELPQGDNMQYFNSNSEGVYIPIYSHDLPVLHNTKKLN
GSVSDNITTNVFPFKQDKGDKGGLEQETSNIKNENLNVSKGFDKQHTAINNDKDFPDDDL
QKWLKEAKVLYAKGIKILRKKGLLDEKQSYFSRAQKRKLNSLSNYKNNISNFSVEDIYPD
SLYPDSLDDFTDNQSYPDENLFYDFSDQFYPEVNLSSKHSSFLARLPSNDNSTLLSSSSK
DDSLRKTKISESFQRKPHAVRKPEEKFESDNKTSYNKEIRNEKNDTKSDPSQMPNLQKDI
KNNTDEKWNSHNNTKNNVDEDKNTQLQNDTSVDKTRNSHNDSENERKSQNNVKNNDTGIS
QIVTKNNSDEARNLQNNIKNNFGKVGNAQNDTKNIRHDQPDHIDHSFEANWDMFENQKTE
KNILNISENQKAKEPIFNMSKNQVTNGLIENFFDNDDRCTYQYAPITVPSCTLDPIRIYS
IHCQIYITYI
Download sequence
Identical sequences gi|449684735|ref|XP_004210702.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]