SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449685036|ref|XP_004210788.1| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|449685036|ref|XP_004210788.1|
Domain Number - Region: 149-194
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0202
Family Laminin-type module 0.018
Further Details:      
 
Domain Number - Region: 192-222
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0409
Family Laminin-type module 0.054
Further Details:      
 
Domain Number - Region: 23-67
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0442
Family Integrin beta EGF-like domains 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|449685036|ref|XP_004210788.1|
Sequence length 265
Comment PREDICTED: multiple epidermal growth factor-like domains protein 6-like, partial [Hydra magnipapillata]
Sequence
MTGQSCAIPCSKGYFGNGCTQKCNCDNFRACDPVNGTCHCKPGYTDPRCKTKCMGTFGES
CQNPCLCNLNNTKECSNVDGNCTCHEGWTGDFCQTPCDNNTAICKIDCNCNNGTCLFDGK
CLCYDGFFGDRCDQVCVNSTFGPNCTKKCNCKNNATCSPIDGTCSCTEGWTGTDCSIECD
NGFYGIDCSQNCSCSIHGKCNRFSGECQCFGEYQGKTCETIAKVFQVVLAASQKSLGRKT
RKSVEIGNLELAVITHAFVYKIILS
Download sequence
Identical sequences gi|449685036|ref|XP_004210788.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]