SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449685925|ref|XP_002167292.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449685925|ref|XP_002167292.2|
Domain Number 1 Region: 196-244
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000142
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 2 Region: 147-198
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000419
Family Laminin-type module 0.042
Further Details:      
 
Weak hits

Sequence:  gi|449685925|ref|XP_002167292.2|
Domain Number - Region: 419-453
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000363
Family Laminin-type module 0.012
Further Details:      
 
Domain Number - Region: 479-532
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000809
Family Laminin-type module 0.017
Further Details:      
 
Domain Number - Region: 564-617
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00781
Family Laminin-type module 0.017
Further Details:      
 
Domain Number - Region: 450-481
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0725
Family Laminin-type module 0.034
Further Details:      
 
Domain Number - Region: 1-23
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0753
Family Laminin-type module 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|449685925|ref|XP_002167292.2|
Sequence length 1199
Comment PREDICTED: laminin subunit gamma-1-like, partial [Hydra magnipapillata]
Sequence
TCSCKPGVIGLKCDMVDSGYFFPNFTYLKFEPEFLSPNGTFSTYYLARNYAKYHTGFGFI
KLDYGQWISFQFQVPTNAYYFIMLRYSLFNLDWYSSILPSGRENVDWDGKNDMQFYLTSG
DQPEKWELVGKIIGENNIEVQNAVFKCNCYAPGSYNWNQCAEYGGQCQCKEGFGDRSCDQ
CVPGYFGSPGVGCSPCHCSDVGSLSDTCHQITGQCSCKQNAHGLKCDECKLGFYHLNEMN
PKGCQECFGYGHLVSCQSAMGFISTYIETSFAESSDTYDNWTLLNEDGSDISSYILQEKD
GIEYTNDKNYLRYFNAPMLFLGNQLYSFGQLLLVEMEIFPMFEVLVSKVPWHVRLIGNGQ
VALFRFKETISKFRTLYSVILHQDYMINATKLREFDFKAMLGYTRVIPYGSPLINCVPCS
CNGRTKECDPQTGECKNCMPGTIGKYCESCMENVLEPKCDKCRPGYWGLYSQLNGCRPCD
CYLPGTQGGNNNECDSLTGQCVCDSQKNVGGRQCNLCKENSFNISLTVELRCQESVSPSA
GTSGSKQVHQVLVENALGETDFTCDCYLPGTQGGNNNECDSLTGQCVCDSQKNVGGRQCN
LCKENSFNISLTVELRCQECPVCYGLIENSVLQLRSNILQVQIQILNMVSKLSSMTVSPF
YQSISSMRSDIINLARRADQGLSVASGLDLLWKSLDNSVNLFLNTLSNSTYAKMESLLMG
ANNIFAIHNSTVFQYSAIFNYLITSFNLINNTVRARMQQQGVALEQLRNLGNEMGGYVAI
ATRRTNEVLTKKYDLKQKIQVSINAAVQAASTAKLTRETAFNMTFTFEPVLLRGREVQSI
ARTCLAAIQDWFRNASRVLLYSQTVLNATTSPLVDNSKNITSLGFLTQALRDRFNGFTTS
VFSLTTNVNSVALEITKLKTSLHQTQISAIERRSSLLYTNIVLLYNKTILAVNIAKKTYD
DAWSMLNTVKNFMVVASQAKRAANEALTQVDNVKITVESALQTAVSISNQLRGPIATIAT
ALQVSNAASLSTGQETQVITSLYQKAVVINERTKSAVSFVKSEQIFVYIQQNVAPLLDRC
NSYKSKSISARKEAQNALTQSQQAFSVAKTTADRIKLLASNIDNLQTVQVSQLDSLIENI
YQGRANYNKLSLSSALENLKKAIADQDLKTKAYKIKKSTLQVSIDRFESLYQSLKQVSC
Download sequence
Identical sequences gi|449685925|ref|XP_002167292.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]