SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449686570|ref|XP_002154755.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449686570|ref|XP_002154755.2|
Domain Number 1 Region: 146-256
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.28e-32
Family Spermadhesin, CUB domain 0.0000982
Further Details:      
 
Domain Number 2 Region: 2-102
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-22
Family Spermadhesin, CUB domain 0.00033
Further Details:      
 
Domain Number 3 Region: 99-144
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000016
Family EGF-type module 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|449686570|ref|XP_002154755.2|
Sequence length 258
Comment PREDICTED: mannan-binding lectin serine protease 2-like, partial [Hydra magnipapillata]
Sequence
MYPNKLNCIWNITVPNGYRLQLNFTEFELEWTDHCSYDYVEVKATNGTIGKYCGKRTEKP
LAYVTAPSKEPIYSVDNSLEVLLYTDFSNEIEVFGFIAHFAALDINECLLNNGDCSQHCH
NYIGGYYCSCRVGYFLHDNNHDCIVSCQNVIQNKMEGIITSPEYPYPYPPFARCEYHITA
EKGYFINLRFLDFKIEDHHESLCPYDYLLIEDEKEKKGPYCGKTKPDNFISFSNWLIVEF
RSDKSLALTGFKAEFKLQ
Download sequence
Identical sequences gi|449686570|ref|XP_002154755.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]