SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449686834|ref|XP_004211272.1| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449686834|ref|XP_004211272.1|
Domain Number 1 Region: 21-276
Classification Level Classification E-value
Superfamily YWTD domain 8.63e-47
Family YWTD domain 0.00000662
Further Details:      
 
Domain Number 2 Region: 709-971
Classification Level Classification E-value
Superfamily YWTD domain 2.49e-33
Family YWTD domain 0.00017
Further Details:      
 
Domain Number 3 Region: 606-700,973-1023
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.13e-17
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 4 Region: 1265-1299
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000126
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 5 Region: 499-541
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000144
Family LDL receptor-like module 0.00081
Further Details:      
 
Domain Number 6 Region: 1014-1050
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000183
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 7 Region: 1093-1135
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000115
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 8 Region: 459-495
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 9 Region: 299-335
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000301
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 10 Region: 1171-1210
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000327
Family LDL receptor-like module 0.00076
Further Details:      
 
Domain Number 11 Region: 420-458
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000353
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 12 Region: 1135-1171
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000484
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 13 Region: 1050-1089
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000484
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 14 Region: 1417-1457
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000994
Family EGF-type module 0.0072
Further Details:      
 
Domain Number 15 Region: 338-372
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000537
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 16 Region: 375-416
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000589
Family LDL receptor-like module 0.0008
Further Details:      
 
Domain Number 17 Region: 1308-1341
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000131
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 18 Region: 579-616
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000223
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 19 Region: 544-577
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000576
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 20 Region: 271-296
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000157
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 21 Region: 1344-1380
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000654
Family LDL receptor-like module 0.0025
Further Details:      
 
Weak hits

Sequence:  gi|449686834|ref|XP_004211272.1|
Domain Number - Region: 1234-1263
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000124
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number - Region: 1390-1429
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0396
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|449686834|ref|XP_004211272.1|
Sequence length 1465
Comment PREDICTED: low-density lipoprotein receptor-related protein 2-like, partial [Hydra magnipapillata]
Sequence
CVCSHGKLSADQLNCEESSEFLIFAKRNEIQFLDLNPFYTSAPYPPITLLDNAIGIDFDF
SRKIIFYSDIFKKEIGSIELGGAEKTTLVKGLKTPDGIAYDWTSGMLYWTDAQEKTINRL
TKNQTKEVLVHDELDEPRAIALSPCDALMYWTDWGKKPYIKRASVNGLNPMAIIETNLGW
PNGLTVDISESRIYWADARTDRIESADMNGRDRRTVIQNVPHVFGVTLHGLYLYWTDWHT
KSVKRADKLTGKNVRIFKDKLDAQPMDIKSTGKCIQLRFKCDGEADCEDGSDEFGCKPEC
KEGYFKCVNGKCIQPRFNCNGENDCGDNSDEESCPPSKCLPNFFKCETSTGCVRDGWVCD
GMNDCADGSDEKLSNCKKDKCSTEDFQCDDQRKCIPLSWKCDKDFDCYDGSDEKICDLHN
ITCSDNKHLCGDGSCISALFNCDGESDCSDGSDEKNCNRTCLPNEFRCLTTSRCIPIHYQ
CDGDNDCGDNSDESDRNGCNKHTCKKGEFQCSDGMCIREDWRCDHETDCADASDELGCNC
NIQTSFKCLSGECLSKIVKCDGTKNCKDGSDESESICPCNGGKFMCRSNSSECILESQVC
NKQKDCSDGSDEKSCFINECAHASLNLCAHICKDLPQGYECLCKNGYKLESDKMSCVSNC
DDYANHGCSQLCQTLNNSINGEHHCSCAPGYSLDINLRSCKHNSDVKPFLLIASKQSINF
LSISQNPLTYDILKRARRDAISADFDWKTQSFFWIDLNPGEIQRSGFSKNSEVKSVLKDI
SPNPFDISFEWIGKNLYFTDWAHDSIYVTNMHGQYKKKLFKDRVNQPLYLVCHPKSGYLF
YTSKTSGINYYGSISRVGLDGSKKEVLFSKDIKYPQGLTIDHVTQTLYWSDSVLKRIEYV
HLSDPKLTRKILVKIAGDVFSLSLFEDYLYYSSQDPFTLNRVHRWTGQNSTVIKKSKDKF
YSVKVVHPLQQPVIDNPCKDAGCSIFCLLSPGTGYQCDCPDNFHISSDGKTCLSNCTTGQ
FKCNNNRCISNAWRCDSENDCGDNSDEMKCDAVNCGSNMFFCNNGNCTRQFYICDGDNDC
GDNSDELNCKDRQCYSYQFRCANDLCILQSKRCDGKNDCGDQSDEEKCTNVTSLCSLETS
FQCKNGQCIAKQWKCDGDYDCTDRSDEQLEECSFKQCPKGFFKCNNQRCILNRYKCDGDN
DCKDNSDEESPECNSEKCNPSNHFLCENKKCISKCNNQNCVAKDFVCDHDNDCGDSSDEK
NCSNMCSKNQFKCGDGKCIESSWRCDNVADCLDKSDEISSKTFCNPEVKFPCATSGICLR
KYKFCNGIQDCEDGSDEKSCPTKDCKITDLKCGDGFCVDEKKRCDYYRDCANNEDENDCA
HSHANSVICDHQCGAHRCVQNGSWIQCQCGPGYKYDENKTCVDINECEQTPLICSQICNN
IKGSFLCKCANGYEHNDIGECKAIG
Download sequence
Identical sequences gi|449686834|ref|XP_004211272.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]