SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449687116|ref|XP_002165254.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449687116|ref|XP_002165254.2|
Domain Number 1 Region: 3-45
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000288
Family EGF-type module 0.047
Further Details:      
 
Weak hits

Sequence:  gi|449687116|ref|XP_002165254.2|
Domain Number - Region: 36-117
Classification Level Classification E-value
Superfamily PKD domain 0.0628
Family PKD domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|449687116|ref|XP_002165254.2|
Sequence length 198
Comment PREDICTED: uncharacterized protein LOC100198726, partial [Hydra magnipapillata]
Sequence
NAGCEKDLCLNNSTCVPNYNDDSSTCKCLSSNFDGTFCERGLKVVLLRYSRQYSYGVPVQ
AFIQEANFKQKSGFSSSSCLLTFNDGGSISNNLGGQAFAYFVPPETGTYYFTITCSYHCV
LYVSTFGKQDRRMYLSAPSIKSPGIYIEKNKKIFLEMLIAIPTAVYGNAYGTSFSLTVTF
PNGTISNPVDNQYLASIF
Download sequence
Identical sequences XP_002165254.2.79663 gi|449687116|ref|XP_002165254.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]