SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449687252|ref|XP_004211404.1| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449687252|ref|XP_004211404.1|
Domain Number 1 Region: 198-341
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000675
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 2 Region: 4-137
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000659
Family Growth factor receptor domain 0.0087
Further Details:      
 
Domain Number 3 Region: 151-190
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000021
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|449687252|ref|XP_004211404.1|
Sequence length 353
Comment PREDICTED: fibrillin-2-like [Hydra magnipapillata]
Sequence
MTLDINECELSSKNNCSANAICNNLVGGYNCTCKSGFNTSDGGIESLSNQCLDVNECVLP
NKNNCSVNATCNNFAGGYNCTCKSGFNTSNGGIESLSNQCLDINECALSNKNNCSVNAIC
NNFVGGYNCTCKSGFNTSSGGVEALLSQCLDINECELSSKNNCSANAICNNLVGGYNCTC
KSGFNTSDGGIESLSNQCLGNIIEDNIIILVNQCIVANPCNWSNSLCLYNNGNYECKCKP
GWVLGNSNVSCVDFDECSQGVCGDLNCVNKIGSYECQCLFGTIFNSSSMLCEVVNECQGM
INEYICNPAEGLCVNVRFPLQPKCLCPKGYAISLEKRTCEVLSQVDQISVDQL
Download sequence
Identical sequences gi|449687252|ref|XP_004211404.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]