SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449687255|ref|XP_004211405.1| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449687255|ref|XP_004211405.1|
Domain Number 1 Region: 455-545
Classification Level Classification E-value
Superfamily Immunoglobulin 3.23e-20
Family I set domains 0.031
Further Details:      
 
Domain Number 2 Region: 364-450
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000715
Family I set domains 0.0057
Further Details:      
 
Domain Number 3 Region: 547-630
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000698
Family I set domains 0.02
Further Details:      
 
Domain Number 4 Region: 267-359
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000188
Family I set domains 0.019
Further Details:      
 
Domain Number 5 Region: 156-206
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000419
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 6 Region: 212-261
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000237
Family Laminin-type module 0.023
Further Details:      
 
Weak hits

Sequence:  gi|449687255|ref|XP_004211405.1|
Domain Number - Region: 117-158
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00026
Family EGF-type module 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|449687255|ref|XP_004211405.1|
Sequence length 633
Comment PREDICTED: basement membrane-specific heparan sulfate proteoglycan core protein-like, partial [Hydra magnipapillata]
Sequence
LIAYGGVLSYTISYEEIGSGYIDLKPDVIIKGNGKSLVYQAQTIVYSREIAHMEVPIHEE
KWTKLSGGLVSREEFLFVLSNISSFLIRATYNTRIKSTLLRNVSLSWPTSNKSDDSVKSI
EVCECPIGYSGTSCQRCATGFFRFITPNGELRCKKCQCNGHSEYCDDVTGICTGCKNNTK
GEKCNECKLGFFSDSSNGGECKPCFCPLSISTNQFSKSCTAMKEGGFVCDTCKTGYSGRY
CGECAVGYTGNPLTPGGTCKKSAVRYTSEPSVKITPEIRKDRLGTISTFHCSATGEQPLM
IQWSRIDGRPFASNVKFASTPTSKTLTITKIDHLDEQTYICSARNDYGLSSARAVLNVVS
HRLLPIRVSVVPKSLYIEQGGVARFICNHDSDLTTTITWSREDFEKLPAEALVKNGIFTI
SNVNQGHSGLYSCRVSNQYSYDQVSVQLRVGVSIPPKVAIYPNEVVSNINEDVQFRCSFS
GYPTPTISWERETGKSMSGNVIIEESLLQIKNVQVDDEGQYFCTASNQGGTVSSRSVLYV
RGPNSLPIVNIIPSEFRVQSGTTVLFLCSYSGIVLKLIWRKKNGNLPTSSVVRDRELHIP
ATDLADEGQYECVASNQYGEVIAKSNLFVEPGM
Download sequence
Identical sequences gi|449687255|ref|XP_004211405.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]