SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449687393|ref|XP_004211446.1| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|449687393|ref|XP_004211446.1|
Domain Number - Region: 3-40
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000311
Family EGF-type module 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|449687393|ref|XP_004211446.1|
Sequence length 195
Comment PREDICTED: uncharacterized protein LOC101240928, partial [Hydra magnipapillata]
Sequence
NSGCEKDLCMNNATCIPNYKDDTASCKCSSTLISGTYCEEEKKVVAMDYVRGNGRDSNIY
LVLSDANFKTKHTSTAFSLTFSGTASDYYITHMFAYFLPPDSGIYYFHMTCRWYGLMYIS
TPGKQDRRVLVWGTGINSKSIYIEKSRKKLIEIVTGGHQEQGQSPIILDVTLPNNTKYSP
IPHRFFDSLLLTKFH
Download sequence
Identical sequences gi|449687393|ref|XP_004211446.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]