SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449688318|ref|XP_004211712.1| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449688318|ref|XP_004211712.1|
Domain Number 1 Region: 51-87
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000419
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  gi|449688318|ref|XP_004211712.1|
Domain Number - Region: 18-55
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.049
Family ATI-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|449688318|ref|XP_004211712.1|
Sequence length 261
Comment PREDICTED: uncharacterized protein LOC101234629 [Hydra magnipapillata]
Sequence
MDIDAKDQKLRRGKCDLAACPMYSSCTLNSAYVASCQCNPNFYNNNGVCADVNECLTSGW
CRGANTYCLNTIGGYSCECQPNYFVNASTSGRDRSCPTFQTCSIGKTCNCTSLINPTSVP
SITFFYGVNDANPATALQFLNIWSDANVKAYCQATGCDQGMLGDIVVNITVYVKRAEEMM
NNSMNAMQQVRDYINCNSYEALEPAWWNLYDVLSSQYIIFKQVRRDLDMKLTFMMEESKR
CETTNADWIRKYLEWFSPVKF
Download sequence
Identical sequences gi|449688318|ref|XP_004211712.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]