SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449689574|ref|XP_002167199.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449689574|ref|XP_002167199.2|
Domain Number 1 Region: 40-176
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000118
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 2 Region: 190-229
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000895
Family EGF-type module 0.016
Further Details:      
 
Domain Number 3 Region: 286-421
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000235
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 4 Region: 239-279
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000377
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|449689574|ref|XP_002167199.2|
Sequence length 434
Comment PREDICTED: EGF-like module-containing mucin-like hormone receptor-like 1-like, partial [Hydra magnipapillata]
Sequence
MPNEDPSTNSDPQPGSSKAQVQGSEELDELTISEIEYLFLVIDINECALSTKNNCSANAI
CNNLVGGYNCTCKSGFNTSNGGIESLSDQCLDINECVFSNKNNCSSNATCNNLVGGYKCT
CKSGFNTSNGQIELLTDQCLDINECALSTKNNCSANAICNNLVGGYNCTCKSGFNTSNGG
IESLSDQCLDINECVFSNKNNCSSNATCNNLVGGYKCTCKSGFNTSNGQIELLTDRCLDI
NECALSNKNNCSVNATCNNLVGGYNCTCKSGFNTTNGGIELLSNQCLDINECALSTKNNC
SANAICNNLVGGYNCTCKSGFSTSNGGIESLSDQCLDINECALSTKNNCSANAICNNLVG
GYNCTCKSGFNTSNGGIESLSDQCLDINECVFSNKNNCSSNATCNNLVGGYKCTCKSGFN
TSNGQIELLTDQCL
Download sequence
Identical sequences gi|449689574|ref|XP_002167199.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]