SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449690070|ref|XP_004212229.1| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449690070|ref|XP_004212229.1|
Domain Number 1 Region: 9-59
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000209
Family Laminin-type module 0.0018
Further Details:      
 
Domain Number 2 Region: 61-108
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000112
Family Laminin-type module 0.0047
Further Details:      
 
Weak hits

Sequence:  gi|449690070|ref|XP_004212229.1|
Domain Number - Region: 127-178
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0103
Family Laminin-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|449690070|ref|XP_004212229.1|
Sequence length 622
Comment PREDICTED: laminin subunit gamma-3-like, partial [Hydra magnipapillata]
Sequence
DPLGSCKKCICNNNIDEKAAGNCNTTTGVCLRCLKNTIGYNCQYCRPGYYGDALAGTCKD
CSCDLVGSFGNDCQNITGYCSCKPNVIGRTCNKCAENTFNFQSNAGCDLCQCDLIGSVSQ
QCDPVTCDCDADFTMTNTTCDALTGQCMCIVSPLGGKYSGRRCNECAVNAIGTPPECELC
HSPCYDNWQKYIDGEVEDINDLNNNVTNLLVRFGSMKYEDISSALSELDINLTYAMNVFT
GGIYNTSAKDKQFNQIEMNIINFESVLNLTKQQLYKSKYYFENTVKNFNGAVFLNTPIPQ
IIPITNITVRLRRQLTNNQKIIDAALITQLAHSFITVTYQQNISGQAVYSLIQNQYRDIV
SANESIADAAVRLSSAMADLSQSRMARSQATDFLDTAYKARFTSNSLELMKIHDIIASTL
LLQNRTVNVYSSSINTLQTAKNFITRADSESIRMNLMADAASQSVSKLKMDAVTLKANVE
GQFSVANNLKESVEDVLYDALQETASLARGVTQLAISRNKTIEARKLSLDIQNYSLPYSL
ADIQSLSNEIISTVVNEGVINETYNDAQIGLLKAQQVQTRSQEAVDVSQKTLQDIKNLEN
SLIQSAAVRSSTQESQNRNEQI
Download sequence
Identical sequences gi|449690070|ref|XP_004212229.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]