SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449690480|ref|XP_002159979.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449690480|ref|XP_002159979.2|
Domain Number 1 Region: 93-136
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000188
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 2 Region: 169-208
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000411
Family EGF-type module 0.0038
Further Details:      
 
Domain Number 3 Region: 39-77
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000699
Family EGF-type module 0.01
Further Details:      
 
Domain Number 4 Region: 131-173
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000046
Family EGF-type module 0.0098
Further Details:      
 
Domain Number 5 Region: 1-39
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000179
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  gi|449690480|ref|XP_002159979.2|
Domain Number - Region: 207-230
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0157
Family EGF-type module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|449690480|ref|XP_002159979.2|
Sequence length 238
Comment PREDICTED: neurogenic locus Notch protein-like, partial [Hydra magnipapillata]
Sequence
LDSCRNLPCENDAKCLNIGPNSFTCNCNDGYYGKNCSQELNACVINPCQNGAACINKRTD
YICSCPPGYDGKNCSINLIGLLLNLSTFVLFSDIDDCANNLCQNGGTCIDGVNFYTCKCL
PGWEGTFCTINIDDCLVNECKHNSTCQDGNANYSCLCRSGYKGERCEINIDDCNPNPCLN
GGNCTDKINSFECNCSAGFLGRTCSSKVDYCFDNPCGEYGNCTSVNNNYITYWQDSLK
Download sequence
Identical sequences gi|449690480|ref|XP_002159979.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]