SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449690520|ref|XP_004212364.1| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449690520|ref|XP_004212364.1|
Domain Number 1 Region: 263-383
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000235
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 2 Region: 177-216
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000167
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 3 Region: 49-190
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000118
Family Growth factor receptor domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|449690520|ref|XP_004212364.1|
Sequence length 394
Comment PREDICTED: latent-transforming growth factor beta-binding protein 1-like, partial [Hydra magnipapillata]
Sequence
MPEAHKDTYDNSPLNDGEVYAIFFRGYTSEGQSFTSPYSQPLLVVEPSSPCGPIDCFSYK
NQTCSEINSTYAKCYCKNGFISFDNLVTCEDINECETLCNTPNTTCINTVGSYECRCNIA
GSFYNTTLGLCQDLNECSSTKPCDSVRGICYNQDILETGKPYSCSCPSGWELAKDGSNSC
VDINECSTLCSGVNAFCINTVGSYKCSCAFGFSLNTSSQCQLKNCSCPLNSKCTMNGNFG
CTCNFGYFPNYMSNCEVIDQCKGTKNCIKPHQFCQNVYANLSFTCLCRDGYQKVGDECIA
IDVSVCNQSLMNNISLCPFNQQCFDSNSSFECRCLTGYEKNEFGQCQDINECKRNISVCQ
PNADCINTNGSYFCKCKDGFVGKNVTNPSTMLCY
Download sequence
Identical sequences gi|449690520|ref|XP_004212364.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]