SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449691186|ref|XP_002165176.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449691186|ref|XP_002165176.2|
Domain Number 1 Region: 626-819
Classification Level Classification E-value
Superfamily Fibronectin type III 1.18e-36
Family Fibronectin type III 0.0019
Further Details:      
 
Domain Number 2 Region: 827-956,1299-1341
Classification Level Classification E-value
Superfamily Fibronectin type III 4.73e-26
Family Fibronectin type III 0.0065
Further Details:      
 
Domain Number 3 Region: 1112-1293
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.69e-25
Family Laminin G-like module 0.0037
Further Details:      
 
Domain Number 4 Region: 467-486,925-1107
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.55e-22
Family Laminin G-like module 0.0064
Further Details:      
 
Domain Number 5 Region: 535-626
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000403
Family Fibronectin type III 0.0026
Further Details:      
 
Domain Number 6 Region: 189-239
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000187
Family Laminin-type module 0.0089
Further Details:      
 
Domain Number 7 Region: 63-131
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000698
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 8 Region: 242-284
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000419
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 9 Region: 288-337
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000446
Family Laminin-type module 0.0051
Further Details:      
 
Domain Number 10 Region: 340-390
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000173
Family Laminin-type module 0.012
Further Details:      
 
Weak hits

Sequence:  gi|449691186|ref|XP_002165176.2|
Domain Number - Region: 146-191
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000335
Family Laminin-type module 0.023
Further Details:      
 
Domain Number - Region: 1-65
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00109
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 486-534
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00419
Family Laminin-type module 0.024
Further Details:      
 
Domain Number - Region: 414-451
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00865
Family Laminin-type module 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|449691186|ref|XP_002165176.2|
Sequence length 1353
Comment PREDICTED: usherin-like, partial [Hydra magnipapillata]
Sequence
CDCHGHGSDCTYLDNAKPYPKYICACDPRTFTEGEQCDRCLPLYNDKPFLRGTIFKANPC
KKCQCNNHADSCSYYRSLDANFNSRNSAGGGVCNSCKHNTMGRYCENCKPLYYRPKGKNI
SSIDVCQPCNCVGPGVVFGNHNCQQDDSTPGIEAGQCNCKKYATGLQCTECEAGYFQLSA
TNLEGCTQCNCDTAGTVSGQITCHISSGQCVCKQNVIGVTCSKCQKGYYGLSSLNPLGCY
PCNCNPFGSLAPDECNSLTGQCTCKDKFEGRACDRCAQGFFGPNCQPCACNINGTMDGTQ
CNKDTGQCFCKQYVTGTECNTCLPGFFNLSKTNFEGCSPCNCVIQGTILNKGECYPNNGS
CLCKKYVTGRTCNLCKAGTFGLTDLNEEGCAKCNCDSRGTWGGDVTPKGELNCSSVGQCN
CRPNVTDTRCNKCIDEFYWNSAGFGCLPCECNLMSSLSNVCNNNGSCECKPNIGVDGMRC
DKCSPCKCNNAGSLFQLCDDYGNCTQCKANVVGMKCDVCKLGTTSLEDRNPYGCSGAPSQ
QGAPFVLFQTSRLINIGWFPPDNLNGILIKYELYRDRTKIFVGLDNNYTDNNLKPYTYYS
YNVISYTAGGSSVSDNGVFRTSSDIPVGVHPVQVSEIKGRSLIATWQEPDFPNGVILEYI
LESTSNFSNTITQYIGFGFFKLVTGLSPYTTYNFTLKACTDKGCSSSVPISIITLFTAPD
SQPAPHLLPLPGGTSVIVFWDAPEKPNGQIQFYEIFIRTEPFLGDGNLIASNLSINNLTF
KVENLKPFLYYEFRVVSYTSILNSVSSNWSKIRTSEGVPAGENAIYPFAEAINSTAVKVI
WNEPSSPNGIIVKFELYRYSLPNIETPILVNVTKNKEWIDIGLLIYTLYKYSVIACNTVG
CTNYSTLVSVMTKSSAPQGQSSPISLGSNSTSIELAWSNPSMPNGPLEFNFVVELLLPSF
SYPPPNVEQGIRFPGQEDMISIELREGRPWFIFDTESGATAFTISTNQTFNDNMWHNVFV
ERLSREGKILVDGIYFGSGTGGGLKNIIGQIEDVYIGSLPEDFKLIRVDNGTAVLRRLPF
IGCLKDFQYNGIPIKFNSSISKSNVSPLSVFCPVSFTSGLYFKDGGYLVLKSLILKEFSR
FKFQLRLRTVKQTALVFFSYGQGVKFFIYFQNATLYLSFKTPSDSGLYTLSSTSICDGQW
HLVEVEILYNQLNMRIDNNQSQVATLPSDFLITSELYLGGIPESSYARTLLFSDDIIEPF
SGCIDMLSFTTIDYIDSVKDFYNIEFDGCPQTPNDVFVCKNSLLSEVYKGKLHYAIANNL
QDFTEYLVRVKSFREDEEGFAISMWSSIHTAEG
Download sequence
Identical sequences gi|449691186|ref|XP_002165176.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]