SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449691926|ref|XP_004212847.1| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449691926|ref|XP_004212847.1|
Domain Number 1 Region: 34-83
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000385
Family EGF-type module 0.014
Further Details:      
 
Domain Number 2 Region: 1-48
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000218
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|449691926|ref|XP_004212847.1|
Sequence length 83
Comment PREDICTED: fibrillin-2-like, partial [Hydra magnipapillata]
Sequence
INPCDNKCNWTNSQCSNTGGDYNCSCKVGFQLDANKTSCIDINECSINKACNWPHGVCNN
TVGSFSCSCSTGWSLSSTNDSCV
Download sequence
Identical sequences gi|449691926|ref|XP_004212847.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]