SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449692320|ref|XP_004212984.1| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449692320|ref|XP_004212984.1|
Domain Number 1 Region: 3-109
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000238
Family Laminin G-like module 0.0091
Further Details:      
 
Domain Number 2 Region: 209-296
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000052
Family Laminin G-like module 0.025
Further Details:      
 
Domain Number 3 Region: 145-182
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000106
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|449692320|ref|XP_004212984.1|
Sequence length 319
Comment PREDICTED: agrin-like, partial [Hydra magnipapillata]
Sequence
GIFFAVGIYDNFITVIFNFGNGVRIVKSHDELSVSRVWHYLVTGYSGQQVYIFIDNQPKV
LYTCYEKLSYLDFTSALFIGGIPFNAILPKSVLLFFSSGFIGALYKLSLRTDSPYFTPIL
FKKLQNDLTETTNIQLENSLGIVMEAQSCQNQLCNNNGSCHEQENVFYCICLHPNKGILC
QDTVLPCVEYNPCHPSSACYSDNNFDINCDCAFGKSGLFCQTNLVISIPFFNDKSYLLLP
GLNIALYTSMEMYFRPDKINGLLFYVANNMNVSSSGDFLAIGLYSGFILMSWYLFLELKT
MTVASFDGSGYWMGQIETV
Download sequence
Identical sequences gi|449692320|ref|XP_004212984.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]