SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|221116369|ref|XP_002164038.1| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|221116369|ref|XP_002164038.1|
Domain Number 1 Region: 442-618
Classification Level Classification E-value
Superfamily SPOC domain-like 2.63e-43
Family SPOC domain 0.0001
Further Details:      
 
Domain Number 2 Region: 180-338
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.85e-30
Family Canonical RBD 0.0045
Further Details:      
 
Weak hits

Sequence:  gi|221116369|ref|XP_002164038.1|
Domain Number - Region: 43-136
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000285
Family Canonical RBD 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|221116369|ref|XP_002164038.1|
Sequence length 620
Comment PREDICTED: putative RNA-binding protein 15B-like [Hydra magnipapillata]
Sequence
MSSPELDHRSRRSSSIKGDRSYRKSYDAYSTNSRGDYGRDFSEKCQVRATGFPAEVSDNE
IKDVVIHEMEKFGDVLNIQLQGHDHNRQAHVLFRDDDAARELRRYCLERHCKVIAFQRAL
HFDFDLNTRKTSSYRSSYSQSNTYKPAYRNNDKYDRNDFNDRSYTNSRDRYNNDNHINPR
ATRTLFVGNLDQGITKDELMRIFEHWGAIDDIDVKRPPNGIPAYAFIKYLELEAAASAKN
QMFGKEINGRLIKVGYGKTQPSTRLWIGGLGHWCSSDLLNREFDRFGALRKIEYVKGSRH
AFVEFESIDAASAAHTEMRGFPLGGPDRKIKIDYAEPDSNCHSSDDHDRTFDSHDSYRNR
SDKYYSEQNNGRKYERHRRTSENDGRRRTRSRSPIENDRHNYKERSKKSSPALLPVHNNK
STDSKSSNGHNYTKVEEINIENLSDVSKRFAVVWRGAFALKNSAFPVKMHLIGGNPELAN
YYLRGIGAGAGPAFKVLNVTQRLRLDQSKLDEVARRVQHAGSSGHCILLALANGDDVELE
DSYQRRPLKSLVTYFRKKEAAGVIILSTEGPSGKQEETGMLHAFPPCAFSHQYLLRTAPN
IGPTPSKEDHLIVIIVKGNS
Download sequence
Identical sequences T2M6D4
6085.XP_002164038 XP_002164038.1.79663 gi|221116369|ref|XP_002164038.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]