SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|221120737|ref|XP_002164081.1| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|221120737|ref|XP_002164081.1|
Domain Number 1 Region: 48-349
Classification Level Classification E-value
Superfamily Kelch motif 2.62e-46
Family Kelch motif 0.026
Further Details:      
 
Domain Number 2 Region: 996-1178
Classification Level Classification E-value
Superfamily Fibronectin type III 9.64e-17
Family Fibronectin type III 0.00013
Further Details:      
 
Domain Number 3 Region: 6-59
Classification Level Classification E-value
Superfamily Kelch motif 0.0000000915
Family Kelch motif 0.021
Further Details:      
 
Weak hits

Sequence:  gi|221120737|ref|XP_002164081.1|
Domain Number - Region: 349-403
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0276
Family Fibronectin type III 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|221120737|ref|XP_002164081.1|
Sequence length 1199
Comment PREDICTED: host cell factor 1-like [Hydra magnipapillata]
Sequence
MALSNMKWKCVKEPSGPSPRPRHGHRAVSIRDLIVIFGGGNEGIVEELHVYNTATNQWFV
PAVQGDIPPGCAAFGFVCDGTRLLVFGGMVEYGRYSNELYELQASRWEWKHLHPKAPENN
ISPCPRLGHSFTLVGKKIFLFGGLANDSEDPRSNIPRYLNDLYTLDLTAQDNLQWDVPCT
YGQPPTARESHSCVLHTAENGKHPRLFIYGGMSGCRLGDVYILDVEKMLWSKPVVHGIAP
LPRSLHASVMIGKRMFIFGGWVPVAIDDGKSSSEKEWKCTNTLACLNVEKLRWEAINVEG
SEEQMPKPRAGHSAVNVHTRMYIWSGRDGYRKAWNNQVCCKDLWYLETERPPGPSRVQLV
RATTTTLEVCWGGIPTADAYIIQIQKYEVHPPALPSTPIQSTTKSSTTTPDFTNALSAGH
VVRLPATSIQLSSPLSFSKTLLASGLSARPKLTMPQPNSLVKVTSSKGLTQLPIQVGGQK
NQHITLAALNQLTAGKISGNLTPNITKTVQIVSPSKSGQITQPLVTSSSIVSQVSVAVDT
KNLSIKSLTSSPAATQYALVRAQLPSSSGGPAQTVTFIRAIGPNSTSATNAGTTVSVTPQ
QMAALLKVQQGQSQVQKVISSATNGGKQTAALSVMNDISVAHTANQPTISVSASPSKLIS
LQFPQKIGLNSIKSINTSSFLNASKAVVTTQSSNISPMGTLVSGIGISKNLSGVLNQTPS
VRPQLPSALSNLGIGSNSNKRQVNSNSPDTTELIDTEKISAQENNIYLNTAKHIELPKVI
SIDNNFVTSSDDNKDSNNTEALHVETSVSDSVSTDHSLAENTLEKTIKNEVSKTLLLERE
LVYKEEIDSKSILSTETPKNEENELFDEKVQNPIPNILENITDVSMIEEKPEIKNETIEA
DASIESVAATTLAQLASYAENINIIQNAPAADISSDPLSTLAALATSSPIATNPLPVGNA
HNTDGIAVSPVLVPPGKKALNKPIPWFDVAMTTNTSIVVSHYYVPVEEGDNNGDNVVSDG
DYKGMRKVELKPGTAFKFRVAGINVCGRGAYSDIAAFKTCVPGFPGAPCAIKITKNEIGA
HLSWEPPTNSAGKILEYAVYLAVDNKKGGKEATQTQLTFVRVYCGSISSCTVTADTLKNA
HVDFSTKPAIIFRIAAKNEKGYGPATQVRWLQDLKDLPDNKLKRQGDQRIDAAKKAKVT
Download sequence
Identical sequences 6085.XP_002164081 gi|221120737|ref|XP_002164081.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]