SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|221124030|ref|XP_002155751.1| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|221124030|ref|XP_002155751.1|
Domain Number 1 Region: 229-281
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000175
Family EGF-type module 0.0066
Further Details:      
 
Domain Number 2 Region: 26-67
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000187
Family EGF-type module 0.007
Further Details:      
 
Domain Number 3 Region: 279-325
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000168
Family EGF-type module 0.0062
Further Details:      
 
Domain Number 4 Region: 140-177
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000469
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 5 Region: 179-226
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000569
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 6 Region: 68-106
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000656
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 7 Region: 329-381
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000691
Family EGF-type module 0.01
Further Details:      
 
Domain Number 8 Region: 379-427
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000296
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|221124030|ref|XP_002155751.1|
Sequence length 621
Comment PREDICTED: fibropellin-1-like [Hydra magnipapillata]
Sequence
MKSNSLETGTVAELEVLSSKLLLFERDPHPCEPNPCNHGGKCSLKKSIHGYECECPSGWK
GFNCEIKDRCSLSTNPCMHGGQCIGMDDHIECKCRARFEGPLCEVDKCADCHQYAFCRHG
HCVCKPGFVGNGFKCNAMGNTCQPNPCDNGGVCKSGQDGKIFSCECKVGYVGSRCEYPNP
CSETPCLHNGLCIDESNKKERGVSITGIRDFKCFCMQGYRGKFCEEIDLAACSSSPCMNN
GTCFDSSSESHKLHLKHPDDYECFCTRGYAGKNCEIKRFPCELHPCENQGTCLDSDNLPF
VSFDAHGYKCNCSKGYKGRNCEISIKTRGPCYYSPCLQGGRCVDFMNNNDPDLHIIDEQE
FKCYCKPQFSGKVCEVPYPACSSFPCYHNSTCVDGTIDPTANFDDTGYLCKCTSGYDGKN
CERQYTSLSLADIGQADSPSEFLSQNQAGAKHENSITGFKGDKAVLNERNVFLKTRDSQD
LKNEFYKNQKQELTSASNNAGQSISQHPSLTQLSKTSKDAINKVKYLNLYNERGNPLLNP
APTSPLVLKKEVLHYPDTNEDNVLHEHNSVERVGKHMTGSVRTFERAATPYDDSTKLATR
GLTASSWPVLYNDWWNNETKK
Download sequence
Identical sequences gi|221124030|ref|XP_002155751.1| 6085.XP_002155751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]