SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449662037|ref|XP_002155026.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449662037|ref|XP_002155026.2|
Domain Number 1 Region: 842-882
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000154
Family EGF-type module 0.018
Further Details:      
 
Domain Number 2 Region: 802-837
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000838
Family EGF-type module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|449662037|ref|XP_002155026.2|
Sequence length 889
Comment PREDICTED: uncharacterized protein LOC100207820 [Hydra magnipapillata]
Sequence
MATKEQMVKQAMYSSKKFLQITLILLINVKYSFSMTLYGERKKDDWMLRKGGLDATKSIL
VARDMEPKTLKYNKTEFETFLKNFTENENLIANEISKFSENNMLINFKELRDKKWKIQKR
CFCYGNSLMHHICEAHNKMHDFGHHAHDVMDHFGDRAHETMHEFGHHAHELKDNFGHDAH
ERLREFGHEAHNTKDHFGHHAHELKENFGHDAHEKLREFGHDAHNTKDHFGCDQHEMLNM
WHQCGDGRCNNNYDKTINYDKIPFEAYNRDNYFNPNQDENLNEQQNSDNIFDDRRLENAA
FGHDSTDKPGEISREHQDNFEENKHGNFDQYERENYNRHRNERKDDFEHPQQYDERKKQY
EDDEIDHYNDLSENKNKDYIGNEDHRSSFANDDSDHVEKDPYATIGNNENEENPLKSEDS
ENEKEQDNSFGENQHKNKANFGENSHNRRKHFGEREHGNKQRFGESQHANKERFGEEEHY
NREHFGEEEHNSRAHFGKKEHKKKERFGESENEFKNHFGEKAHEKQNNFGEQEHKYKEEF
GKTAHENQAHFGREAHSSKEHFGEEEHENKENFGREAHMSREHFGENQHEKMKHFGDKAH
KNLENFYIKSKEQHKNKEHFGEKEHDNKKHFGEEAHKTMGMFGKSAHEKMKNFGLQAHKN
LEMFGVKDFQKRMEHFGEHAHEHKDEFGIEQHKTLANFEHISRDHREEEAKKQREHFGEQ
QHEKKKHFGEGDPEYHSRCAHDKLRNFGKFAHHYGCGINFAQYRSKIENAVKQKTNQQKP
YYRKYKPKLWPEYPQVLLKQNNCDFCENGALCVTEPDPIKFTCYCPYNYEGNRCEIYSPQ
KKACSQNTCYNGGRCEERPNKKEKFHCYCLSGWHGQQCTEKDIMDWSKW
Download sequence
Identical sequences gi|449662037|ref|XP_002155026.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]