SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449662827|ref|XP_002155563.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449662827|ref|XP_002155563.2|
Domain Number 1 Region: 372-494
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000722
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 2 Region: 3-132
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000173
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 3 Region: 86-208
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000408
Family Growth factor receptor domain 0.023
Further Details:      
 
Domain Number 4 Region: 212-333
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000283
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 5 Region: 329-377
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000951
Family EGF-type module 0.026
Further Details:      
 
Weak hits

Sequence:  gi|449662827|ref|XP_002155563.2|
Domain Number - Region: 496-533
Classification Level Classification E-value
Superfamily SEA domain 0.000131
Family SEA domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|449662827|ref|XP_002155563.2|
Sequence length 539
Comment PREDICTED: fibrillin-1-like [Hydra magnipapillata]
Sequence
MTNNNVNECLLGTHHCHKDALCLNNKGSFQCSCLDGFNGDGINCQDINECAAQTDNCHTD
ATCNNTLGSFLCNCKHGFEGNGTYCKDLNECLQGKHNCHMDASCLNLKGSFQCSCNNGYI
GNGIYCQDIDECFNNSCHKDAACKNTLGSFQCKCHAGYNGDGHLCEDINECERGKNNCHE
NAYCENKQGGFSCTCWSGYKGNGTHCSDLNECVLDHKCSENAYCTNTKGSYNCTCSIGYI
GDGTICKDDDECLYKSIYCHSESICTNSIGSYKCECKNGFHGNGVVCQDINECVDQHNCH
KDAICSNTYGSFRCMCREGLFGNGTFCQDILECSTYNKCHSDAICIEQYASYSCVCKAGY
EGNGQTCADVNECAIKDLNICSKHATCINTHGSFQCKCIDGFIGDGFVCVDVNECEEGED
NCHSMANCINTIGSFKCNCTSGFHGDGFKCEDTDECILDKNICDKEKGFCINTNGSYACG
CKEGTVGDGVYCRDLLSMYLIIVSILNLDWNVDLYDKSSLKFNKTSDYIQHQVIILAKD
Download sequence
Identical sequences gi|449662827|ref|XP_002155563.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]