SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449662829|ref|XP_002165678.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449662829|ref|XP_002165678.2|
Domain Number 1 Region: 79-181
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-24
Family Spermadhesin, CUB domain 0.00055
Further Details:      
 
Domain Number 2 Region: 264-402
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000157
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 3 Region: 9-71
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000183
Family Spermadhesin, CUB domain 0.011
Further Details:      
 
Domain Number 4 Region: 181-230
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000129
Family EGF-type module 0.02
Further Details:      
 
Domain Number 5 Region: 228-267
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000134
Family EGF-type module 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|449662829|ref|XP_002165678.2|
Sequence length 408
Comment PREDICTED: fibrillin-1-like [Hydra magnipapillata]
Sequence
MHLHQKRDLDCKDATDWVIVRDGNTTESPLIDKLCAWRIGKKILSSKNYIFIHMKTQERH
RGFRLDYQGICTLKMKFYEGIIESPQYPRSYPSSSLCEWTIDFGFGFNTRLYFTKFYLEK
SNCSYDYVAIFTGPNSSYPMLGKQYCELAPPPLTVLGPMTIVFRSDHDTELEGFQALYSA
SDVNECNFDNNCHAFAFCTNTFGSYTCTCKLSFEGDGISCAWYRDFNECLEGKNNCHQNA
NCIDTKDDYECLCKSGFSGDGVKCSDVDECSEKLHNCHTNATCTNTIGSFKCSCIEEYEG
DGINCEDRDECQMELDICHIDANCLNTDGSYSCMCKTGYLGDGINCHGKDIREMDLLAQP
DVNECVQDSFHNCHKDADCINLVGSFHCTCKNGFEGNGVTCRGSNYFL
Download sequence
Identical sequences gi|449662829|ref|XP_002165678.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]