SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449663135|ref|XP_002156276.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449663135|ref|XP_002156276.2|
Domain Number 1 Region: 899-1042
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.16e-16
Family Leech intramolecular trans-sialidase, N-terminal domain 0.038
Further Details:      
 
Domain Number 2 Region: 196-233
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000034
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 3 Region: 111-243
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000973
Family Growth factor receptor domain 0.0055
Further Details:      
 
Domain Number 4 Region: 769-806
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000162
Family EGF-type module 0.014
Further Details:      
 
Domain Number 5 Region: 491-526
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000174
Family EGF-type module 0.022
Further Details:      
 
Domain Number 6 Region: 565-599
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000184
Family EGF-type module 0.01
Further Details:      
 
Domain Number 7 Region: 326-363
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000254
Family EGF-type module 0.016
Further Details:      
 
Domain Number 8 Region: 860-897
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000415
Family EGF-type module 0.01
Further Details:      
 
Domain Number 9 Region: 527-563
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000112
Family EGF-type module 0.019
Further Details:      
 
Domain Number 10 Region: 601-635
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000138
Family EGF-type module 0.015
Further Details:      
 
Domain Number 11 Region: 424-462
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000207
Family EGF-type module 0.012
Further Details:      
 
Domain Number 12 Region: 51-90
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000215
Family EGF-type module 0.014
Further Details:      
 
Domain Number 13 Region: 288-324
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000177
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  gi|449663135|ref|XP_002156276.2|
Domain Number - Region: 263-300
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00065
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 406-423
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0273
Family EGF-type module 0.039
Further Details:      
 
Domain Number - Region: 236-255
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0328
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 365-385
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0449
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 464-488
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0979
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|449663135|ref|XP_002156276.2|
Sequence length 1047
Comment PREDICTED: neurogenic locus notch homolog protein 1-like [Hydra magnipapillata]
Sequence
MLLGWSQEHISKADSSLESMASILHVGETNENAVEKSQISFPRDKTPVSKSPCEFNPCSN
NGMCVNDPGLSRGYYCECTDEYQGTHCEERKCKCQNGGSCIGEGVESKCFCKAGYGGITC
QEHTQCNEDTCLHGGVCIEQIGGFKCKCDNGYKGQRCEEYDKCKPNPCLHGGRCLDFGDF
SKCECKKGFKGKQCEDIDFCVPNPCQNNGQCFGFPGGFQCECPKGFNGKTCQHIIHCLSN
PCLNGGECSEVGPTYDKPHGSFNLGVCSSSKSGFTCQCTEGFKGITCTESDPCFPNPCIH
GKCTEFGGSYSCSCTLGFKGLNCGEIAHCEPNPCFHNGVCQEIKGGVGFVCQCVSGYKGQ
MCQKKDLCNPNPCSNDGKCSDLLEDVQVTPNSLLSGNYVPQKRASEGEIKCTCAAGFMGE
RCNQINPCYPNPCEHNSLCIADHGANIQCNCSLGWKGKHCEEADLCAPDPCRYGTHCQQT
SAESYTCLKNLCSPNPCSNGGQCIVVNDEAFQCACPRGWRGKICSEQDLCVPNPCENGGV
CHVNNDAEFSCECVDDYIGAKCQGFCAGYPCKNGGTCLDTDGGFTCRCNNGFSGPFCDES
VCFGAPCENSGTCVPYYGIALCKCTEGYTGAHCSEIKKRGPKSFHISQQQDQQQPHSTVT
KSQVTNVSPSAILFQRVEEILNSDKEVDTIQPNLIEGSKLTAENDKPKHITPPTHSSNPV
IAPTEIQTISPITFRLPDLLTTLTYPTTAIQPAPTFLVHVQSKSQSIDDVCNPNLCEHGG
TCVVRSDNQPECICLTDFSGPRCEDIGMLGYSSAPKFFPNDECNHCDKNAVCTNGHCICA
KGFVGDGLECWPFSSADSEWNCNPNPCQNGGTCKNGRSHCVCRLGYVGIFCEKYCPPSVH
LSFDSKKDNFVQDESGNENNAVLMNGAKVVYEGGKCDSGVSLSGGDILFDGEKFKNKPVD
AITMALWIKLDSTSGIQSVFDTVGGKHSTHRDGQYHVEIDNGKIRWFHRNEYHMTIFSVV
TKPILQNNVWTHIGGTYNAAKREAKVD
Download sequence
Identical sequences gi|449663135|ref|XP_002156276.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]