SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449663568|ref|XP_002157033.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449663568|ref|XP_002157033.2|
Domain Number 1 Region: 350-387
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000472
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 2 Region: 235-274
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000193
Family EGF-type module 0.012
Further Details:      
 
Domain Number 3 Region: 274-312
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000363
Family EGF-type module 0.021
Further Details:      
 
Domain Number 4 Region: 389-424
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000522
Family EGF-type module 0.011
Further Details:      
 
Domain Number 5 Region: 313-349
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000249
Family EGF-type module 0.015
Further Details:      
 
Domain Number 6 Region: 425-473
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000548
Family EGF-type module 0.0079
Further Details:      
 
Domain Number 7 Region: 550-602
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000568
Family EGF-type module 0.015
Further Details:      
 
Domain Number 8 Region: 199-235
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000165
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  gi|449663568|ref|XP_002157033.2|
Domain Number - Region: 504-546
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0419
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|449663568|ref|XP_002157033.2|
Sequence length 621
Comment PREDICTED: fibropellin-1-like [Hydra magnipapillata]
Sequence
MSNLTIKVLPKKLVTINNTESAVLNNTEKSSLTECPSKECALGSDSRSKDDQKKINTSSI
NHESHAIKQVNYNLGRAHHKISSVEPAVNIANVTEGNIDDTGYHQSHPDLLSDKTQYANY
LHVHDELQQNASGKSSIANASENAHHMISPNYEESDLPIQTYEHHHADFGSIYSNSNGDS
SLPIVHHHHFNEPEQIEHSEFHEYPCLNGGVYYNTGEKGYQCTCIEGFTGANCQEVNHCY
PQPCLNNGVCHPVDYSPFFICQCKVGFIGIKCNETNPCYPNPCKNNGVCSHNGTDVTCVC
SPKFTGAFCEKSKSCLVNPCRNGGVCIELEGDGKFQCHCQQNWKGPLCADFDHCYKNPCE
NGGICLEGFNNFSCKCLNGFSGVTCQDHVCSPNPCLNGGTCLENGDKFKCICPKWASGEL
CEENRPCLINPCLNDGKCIDGSSGFQWSFAPLQYYCLCKPPYKGIHCERHGCKHCDKNAH
CVVDHCVCNPGYEGNGFICHKKENMCHPNPCFNNGHCIESPANCQGDNCGFTCVCLAPYL
PPLCKEANPCVPNPCENGECQSIGNGDVMCKCNEGFKGKLCGEIDACFQNPCQHNGKCHS
VKGIASCTCAGMWKAPFCKGS
Download sequence
Identical sequences gi|449663568|ref|XP_002157033.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]