SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449665014|ref|XP_004206046.1| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449665014|ref|XP_004206046.1|
Domain Number 1 Region: 68-206
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000235
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 2 Region: 19-67
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000875
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 3 Region: 379-504
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000014
Family Growth factor receptor domain 0.021
Further Details:      
 
Weak hits

Sequence:  gi|449665014|ref|XP_004206046.1|
Domain Number - Region: 1-26
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00032
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 311-371
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000439
Family EGF-type module 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|449665014|ref|XP_004206046.1|
Sequence length 509
Comment PREDICTED: fibrillin-1-like [Hydra magnipapillata]
Sequence
MCSCNNGFQLDTSKASCVDINECATTCNWKNSNCANKIGSYICSCNTGYQLNSNMTDCID
INECATMCNWDNSNCTNTVGSYYCSCNYGYQFNSRRTSCIDTDECLTTCNWGNSICTNTI
GSYHCSCKSGFQFDASNTSCVDVNECLTACNWNYSNCTNTIGNVNECIVDKECSWLYGAC
NNTYGGFNCYCTGDWLLSDTNKSCKPATAVTAQSFQITVGSFLTGLVIRYVEVIIRKQSD
FIIPSKSPSQYTSEDIDNHLDGWHRFAKVTVSSNEISSIKLSSKNGNSIAVNSGNSKSAP
GRKRRSLDTLCASISCFKFKNQICSLVNSTSPKCFCQNGFISFDAYSTCEDINECNLSCK
FPNATCTNKYGSYECHYTNECLNSCNGVNAFCINTIGSFECYCAAGFLLNSSFQCEAINM
CSQINCPSSSNCSMIGLGYFGCTCKPGYSINYMSSCEAIDTSICNHALSINASLCPSNQQ
CFDLNSSFECRCLPGYMKNGSDECEGYID
Download sequence
Identical sequences gi|449665014|ref|XP_004206046.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]