SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449665118|ref|XP_004206071.1| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449665118|ref|XP_004206071.1|
Domain Number 1 Region: 644-706
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000945
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 2 Region: 547-608
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000473
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 3 Region: 606-645
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000891
Family EGF-type module 0.059
Further Details:      
 
Weak hits

Sequence:  gi|449665118|ref|XP_004206071.1|
Domain Number - Region: 200-225
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00111
Family EGF-type module 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|449665118|ref|XP_004206071.1|
Sequence length 1143
Comment PREDICTED: uncharacterized protein LOC101238011 [Hydra magnipapillata]
Sequence
MAKLDIFESFTNAITIPCLKSFSGALKVKYRCFSKVLECHPQCEKENSTCIFTADGSKCL
LNSNLGIFGTDYSYILYSEQHLMIGVILRATLFEPCGAILVYWRIKYIGCRKIRTPSEES
EINISNIVTPQICIKVCQMLGYTYAALGETHTKCSCYQNVTYFEVAEEESCLSACSYNPY
YSCGNGYNKHVFHTGIKNLKCSESPCPEGTFCVQFYEDYYCLCNETSKEQPKGCYGCLEG
WSTTPDSTECFIMINNLNSRNLSNDCRRYHGVSLYNTSEKTNFFLLAFLANKLLKSSLGE
ANELQLQLINKNITNQTMPICRRIKSAVIGTYPWTTWPSGSYGLPMPVSGCPDGHNFKWD
EGFYRQYTEHTNNQNEISDSFHLFGEVTKEYVFRGFCIKVEESFTEWPNGQYCIYKKGEH
CPTNMVEGELFWDDEDTNNNNTATGVLPEGMFKRDTQIFYCCTTGEINQDGILLPRERPF
YLFPYKFPICQHVIGTESSLEFIQYDIESYYENIGAAVAKGERHPYAEIVLPGYHLKIYY
CYYKPIKSCGRPRHHSDLLNTQKNETYKVGDIVHYVCKNGYKNIGDEYDECLPSEHWSSV
VGPKCVDVNECTDNRACHVKANCYNLLGSYICKCNPGWVGNGHTCRVAFCIPPSPLENGF
HSNIKTEYAVGEYLFFKCSPKYLLIGSDSTVCQENGQWKSIFPVCKNRRVLIKVIRANVL
HHIFLNFLTQRVPVNMWKKTDPPERAETSNATLVAALTTGSIALFTMILIVITFTLLKWR
KRERRLRDISLKSNTSVYADIEEFRLNLKMNRKKEFRRSSCFSTNTNAVVSWDSKPNLPP
RISVCKSVSGTKSNSQFSSSISKFRRHSDFPLSESFLLPPNQFLSAISQEKIKRSFPSKQ
YNGFSPTQDDATSGLTEKRATIASASLCSQKVPFCSKNATTSLYSENNASQNHKQIDGSL
SEYTENPYIDMNTDQFSIRSENDESENSLLTDHYGQTPKNTLRISLRHRSFTVGNTDKIA
ADAGEKDVNKLNKSSSYNSLQSNAYLNSEQANICFNSSQQPIIGSFQHDESCDVKKGDQV
LIINNWEDIAETDFSLQLKLPSAIKKNNKDWRMTMEEFSSRFFRYKIRCKLSSGRKRSET
NPL
Download sequence
Identical sequences gi|449665118|ref|XP_004206071.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]