SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449666107|ref|XP_002168125.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449666107|ref|XP_002168125.2|
Domain Number 1 Region: 340-393
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000273
Family Laminin-type module 0.034
Further Details:      
 
Domain Number 2 Region: 879-931
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000363
Family Laminin-type module 0.007
Further Details:      
 
Domain Number 3 Region: 833-881
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000586
Family Laminin-type module 0.031
Further Details:      
 
Domain Number 4 Region: 987-1033
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000026
Family Laminin-type module 0.0044
Further Details:      
 
Domain Number 5 Region: 779-826
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000698
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 6 Region: 938-989
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000159
Family Laminin-type module 0.0081
Further Details:      
 
Domain Number 7 Region: 277-330
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000019
Family Laminin-type module 0.038
Further Details:      
 
Domain Number 8 Region: 521-561
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000502
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 9 Region: 1039-1083
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000109
Family Laminin-type module 0.0058
Further Details:      
 
Domain Number 10 Region: 437-472
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000109
Family Laminin-type module 0.024
Further Details:      
 
Domain Number 11 Region: 470-513
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000019
Family Laminin-type module 0.021
Further Details:      
 
Domain Number 12 Region: 1091-1133
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000977
Family Laminin-type module 0.039
Further Details:      
 
Domain Number 13 Region: 1141-1187
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000419
Family Laminin-type module 0.0086
Further Details:      
 
Weak hits

Sequence:  gi|449666107|ref|XP_002168125.2|
Domain Number - Region: 101-176
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00151
Family APC10-like 0.04
Further Details:      
 
Domain Number - Region: 1225-1317
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00547
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number - Region: 1373-1397,1430-1628
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.00811
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|449666107|ref|XP_002168125.2|
Sequence length 1818
Comment PREDICTED: laminin subunit beta-1-like [Hydra magnipapillata]
Sequence
MNGRTQNLWFSTFRLVIVYALFFAKLCFGQEECLRGGCYPATGDLLVGRENRITATSTCG
LKERTKYCIVSFLEKDEKCFWCHSTPEIESSGNRYKYSHLPKYMVTQVPADRLKGWWQAE
NGVENVTIQVDFEAEFVFTHLIMTFKTFRPKAMYIERSLDYGKTYSVYRYFAYNCAQSFP
NIPTGTQHNIDDVVCEERYSKVEPSTLGEVVMKVLDPTVQKEQDPYSLSVQRLLKLTNLR
IRFTELHTFGDIVLGNSGTKSTNYYYALYELVVRGSCSCYGHAEHCIPSPDAPTNVNMVH
GMCNCTHNTQGKNCQECKDGYNDLPWQPSYKDKLSVCKKCNCNGHSDKCHFDIAVYNANG
KTSGGVCDDCQHNTHGRQCEQCKPLYYRDPFKNIFDPDVCKQCDCDPSGSIGRGECETVS
SVVKLGSEEHLSSIPGKCICKSNVEGKRCDQCKNGFWNLLESKSEGCQSCNCDERGSVEI
NKCDQQTGICRCKRNVQGFTCSKCMDGFWALGSTKEGCQKCGCDVGGSVSSVCDDISGSC
QCKRNIIGRQCNLVQTGYYVEDLSHNKYEGEDSVPGEVDTPFNVRKIIVNEGDNITWTGE
GGVGVKEGSVIEFSTVRVPSTGSYKIYIRYDAKNHGKWRDVVVTVKRKDGRELGGDGCAV
INDNKVLYYPILSEFKMNEALTNDICFVKGVVYDVQVNFIKNLGEPDGETFVDSIVLIPN
VDDFDVMEGQDGAYYKDLWEKNNCLDYYLNPVLEKQVPDVCKKIQFSISTQLNNGASSCD
CDVQGTVSTGLSEKLTCESIGGQCPCKPGVIGRRCDRCKTGYYGFGSEGCKACNCSRVGS
KNLLCDDFTGECLCKEGLEGRTCNSCPKNHFGFPDCKPCKCYGHSSTCDAATGVCNNCLH
NTKGINCQLCKDGYYGNALLGTENACQRCQCPGGSSGNQFSNTCELRDVGKVFCTNCSEG
FTGTQCEKCDNGYYGNPLIQGGTCKKCLCNGNINSASTPKCDSATGKCFNCLNNAFGDFC
ETCKPGFYGNASKQSCKACECNSLGTNNNTGGYCNSVSGQCPCLPNVVGMNCDKCADGFY
EMIIGKGCRNCMCDLEGSLDGTCDKTNGQCKCRVGFGGQFCSECENYSWGMPKTIKGCKA
CNCNPAGSADLQCNRTSGVCKCKPNVVGEKCDMCAPRTSGKMPTCSNCHTCNDQWEDIIN
ELEIKILNLKRLIGNVTFNASEISSYNQDIEELNDRLIDIENYMKNISLTAQEVDALRTK
HTAFKLLLDGLALKADNLSVVVANNTQRLQYDNIELDMLELRMGSLKKDAKDFRENVTTL
QEGNIEGGFNSTLDSQRRSREAQQLINVTDDIISKSKVTRRKIKNTIISPKNDKSFEKLD
KDNNKLLDNLTEYISLLELKLKALNAILCGSKENTSCGCDRISCISCNCDGIRNMVDIAF
TDAKQAAFVTEEKKVAVNHMVENLKVVQALALSSKEAASSASKSSNEAKRIAENAVNNIT
SLIQEILIFLNSSTNHPNISRALSLETIKLNISLTPDDVKELADQIRQVVTNLTDVDRIL
NESKKDYDRAIDLKNKAMDIKKYALYVVNKTQTVLDQLSEAALLQNYTASNISIGYIKHK
EATDLIIEIEKLLAETEGALDVSLNKTNKLENKRKRILVMFEKNKQNLRKAEIEAENAKE
VGQDVAESSEELSKNYQKADEKLKIKVNETKNLRDRVQALLDNAVKLFENADKQMKKIDI
LKTIYKKNQDLVEDLSKELRILEIKAKYTRDRLIVLDKWHGGCNPDLSVKVDPNLAGVKV
QFIKDLKDAGGCDNNICQ
Download sequence
Identical sequences gi|449666107|ref|XP_002168125.2| XP_002168125.2.79663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]