SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449667989|ref|XP_002160198.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449667989|ref|XP_002160198.2|
Domain Number 1 Region: 585-768
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.09e-30
Family Pentraxin (pentaxin) 0.0017
Further Details:      
 
Domain Number 2 Region: 861-1008
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.29e-24
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.001
Further Details:      
 
Domain Number 3 Region: 1097-1238
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000989
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 4 Region: 1291-1355
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000108
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 5 Region: 1407-1467
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000139
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 6 Region: 1538-1590
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000124
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 7 Region: 337-379
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000255
Family EGF-type module 0.0051
Further Details:      
 
Domain Number 8 Region: 1252-1302
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000306
Family Complement control module/SCR domain 0.0029
Further Details:      
 
Domain Number 9 Region: 171-320
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000381
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 10 Region: 1018-1057
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000328
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 11 Region: 1351-1415
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000106
Family Complement control module/SCR domain 0.0037
Further Details:      
 
Domain Number 12 Region: 1470-1534
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000181
Family Complement control module/SCR domain 0.0037
Further Details:      
 
Domain Number 13 Region: 375-417
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000162
Family EGF-type module 0.0084
Further Details:      
 
Domain Number 14 Region: 490-534
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000239
Family EGF-type module 0.016
Further Details:      
 
Domain Number 15 Region: 529-569
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000326
Family EGF-type module 0.017
Further Details:      
 
Domain Number 16 Region: 1607-1671
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000484
Family Spermadhesin, CUB domain 0.0071
Further Details:      
 
Domain Number 17 Region: 449-491
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000634
Family EGF-type module 0.017
Further Details:      
 
Domain Number 18 Region: 415-457
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000798
Family EGF-type module 0.022
Further Details:      
 
Weak hits

Sequence:  gi|449667989|ref|XP_002160198.2|
Domain Number - Region: 1069-1112
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00043
Family Complement control module/SCR domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|449667989|ref|XP_002160198.2|
Sequence length 1689
Comment PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1-like [Hydra magnipapillata]
Sequence
MDCNAIFANNTCHCSEWRWKDQTNGNEQETSTELTYEGDCHSKAVQEQIKNEFLKSLCLY
CDFDSLEVFCGSASLVFRRKRSTFKTVSIKASVLLKVSKEEIRNNAVVAKQILKNQINQE
MPKFINRVKNFKEWSAVLLKPSAFRSVNLIGNVKEVCGDPADIQDLTQRLDERCVVCGAG
TFKNFTSNKCEKCPDGMFQPNPGQTKCLSCPPGSIATERDSKDFTSCKELCLPGHYSMNG
FSPCNQCPLGTYTNVSRSTSCVKCPTGTTTFQFGATSVFDCGTACLPGTYSANRVEPCLR
CPKGQYQDKYGQVKCEWCPDLKTTSSIGSVSVSSCLDINDCSSSPCLNGGHCIDLRDDFR
CECQKGFWGETCEKEVDECQLQPCINNGTCLDKFQSYKCICRPGTGGDNCGQVLKKCTTN
HCGKNGRCIDLADQKTKCVCNDLFVGEFCEGKVDPCYPDPCSGVGFCEPIGNNFKCHCLR
GYTGETCQNKWNFCDSGPCQNNGLCHDKKTGFLCECAPGYHGEQCQHKFNMCVYKKCHNG
GVCQSISGDINCLCAPGFSGKQCDKRETEDFDLSFQSTLSPSFSSVHGRKDLSSFSIAFW
MRTSNKEKFGTPLSYAVKLENGVVDDNALVLTDYTNFIIFINNQSQSLGFGANDGKWRHI
VVTWSSSSGLLTSYKDGVLQKRGSIPIEQGKKIPKGGIFIIGEEQDEFGAGFTPAESFYG
DLSQLNVWDYQLEEKEVYNMATKCFHAIGNVIAWSDFNSQSHGAVVKTSPSLACNYQSTL
REFQYLKNMKFADNILKNDKLAIQKPTFTSEECSKQCAETAGCHSFIINKDRGCTMLSAS
PIIDESVPITSYNDDLYFSNCVAPLGMGDKRIPNTDITGMSVKGQAYGHLARLHNVPEGD
KKVAFWQPSAGKKDELIEIKLGKLTRITGIATQGHYDENIQEFVSNFNVYYNDMNTWKEY
PKTFKANTGPIDVVRNDLNIITDIVRLKVTNQGSTDSIALRIELYGCPLDPQGVPIIRQD
VNDCKANPCKNGATCIDLYQAFFCKCQLGYSGKNCESSDCSVNDIDAPIHGLIIKHSEYA
EFKCETGYQLVGISQIKCLNGIYQDHRVPECVDIDECKLKYCSDGCENTIGSFKCYCPIG
KILDPRNQMSCYDENECQRNTGCEFGCDDLVGSFSCKCPKGYFHQPGQRYCYDFNECDSS
STNKCEQLCQNTLGSYVCSCRPGYMLAPDGFSCIFQKCSDLPVQIKNGVCKVTKDIAVYS
CDTGYKLNGVKERFCAADKTWSGSVPFCQPIKCVEIFAPENGQIKLDGFHFNAKATVTCN
PNFKLFGSSVRYCTANGWDGMPPYCSVEVCPPFFVLNGRTLGTSPVVGSAVRIECDTGYT
LIQQNLLYRTCQSNGQWTGGNQASIECKIIECGPVENTGNTRYEYVGGQKYNNIVKYSCV
AGHCLEGSSVRRCQANGKWSDNAPKCISNSCCSPYVPPHSKLYSDNSFSPGEYVYIKCDQ
GYKSSGTELRICQKELVWSGEDTTCNIVDCGHPTGNQIMKNGEIHMSKTTYLARALFYCQ
PGYLIVGSTERICQANGNWSGNVPVCIKDANGGHVRKESGSLVCLHQSICHWLIQVTQGK
KITLDFLTYDVQNGGKTEVYDGENFKEPFITFTKGFEPRKITSNSHFIRIISSGYITFNF
SESLPLFSV
Download sequence
Identical sequences gi|449667989|ref|XP_002160198.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]