SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449668266|ref|XP_002154205.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449668266|ref|XP_002154205.2|
Domain Number 1 Region: 249-288
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000269
Family EGF-type module 0.016
Further Details:      
 
Domain Number 2 Region: 174-213
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000158
Family EGF-type module 0.008
Further Details:      
 
Domain Number 3 Region: 311-349
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000221
Family EGF-type module 0.011
Further Details:      
 
Domain Number 4 Region: 138-173
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000018
Family EGF-type module 0.028
Further Details:      
 
Weak hits

Sequence:  gi|449668266|ref|XP_002154205.2|
Domain Number - Region: 117-136
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0142
Family EGF-type module 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|449668266|ref|XP_002154205.2|
Sequence length 589
Comment PREDICTED: uncharacterized protein LOC100207686 [Hydra magnipapillata]
Sequence
MAEHGFGEQNPIKQINDMSMESKAKYLYKRSINTTMNSGLVILLRSKVKSNLRSVYLKKS
SKDELMKHNFTNLHNSLSSYFIKKQVKSNNDNEYSDKNRIKRNEDDLPSGVNKNDLNFYG
FACICPMRFKGHKCEIPEPCNPNPCGNNGVCSDKNGVPSCKCEYPYVGMTCNATDSCKPN
PCKNAGKCTDNDGVAVCTCLPRYEGDKCEIDRCDQCHTNAECSNGVCKCKQGFLGDGKIV
CVKDRAFSDPCNDQVCNNGGTCVATSETSFRCFCKSMYYGKFCEEKMHPTPAVLTTTSTK
TTQKSVQTTDRPQCHPNPCLNDGQCIVSGDIGYNCLCTPQFKGQHCEDDKCMECDLQALC
VDGHCHCHHGYHGDGYTCTKNDQCDEPCPRNGICTHGICVCEQGYYMDEDKCKRVPFAAK
HNPHERRLELVHSKTSLSPPPPSPPPLLGTLPPPQSHSQHTPLSPPYLQPVLLNSPNPVN
YLTSLPKYTSYQQPVAVNPPNSYMTTSTEHYMLPNNYVINSNENIFKPTSLNVQYPLLDS
QPIVSPAKPIISLTSYNQQSNQNPFIRSPMEKFEKKLKDLMALGLLLIV
Download sequence
Identical sequences gi|449668266|ref|XP_002154205.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]