SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449668438|ref|XP_004206787.1| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449668438|ref|XP_004206787.1|
Domain Number 1 Region: 52-111
Classification Level Classification E-value
Superfamily BPTI-like 7.8e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0016
Further Details:      
 
Domain Number 2 Region: 542-585
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000636
Family Psq domain 0.027
Further Details:      
 
Domain Number 3 Region: 10-50
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000104
Family EGF-type module 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|449668438|ref|XP_004206787.1|
Sequence length 642
Comment PREDICTED: uncharacterized protein LOC101237347 [Hydra magnipapillata]
Sequence
MFPDFYNHPCTINNGNCSHLCLSSKDWHKCDCPDGMSLMSDKKNCENSSTITPGPWNICS
MPSDHGPCQNDEIKWSFNPLTKSCQQFLYGGCGGNENNFDSKENCENDCGGNSCNPQNCN
NGGYCSNKSLSKCSCVDDWFEQLEFYYRWKHVFRDNQRRSSTMNVSFTKDNFYISQFQYQ
NDFLNIVFAIVSSMDVVMKKESIEAGFRNFSSKFEDFFNVSLLHVGGIKYAQLQRRREHN
SVFVPVIVSLIIVISVLLILLVYLKYKKRPFLRHSQVHWSFRNQEYNDTFPHETSLPTDL
PPSAPSYINPMFHATNFDHLENDFEIKKIAPKEEIKIEASNWVQFTDDDEPKKFPITEFV
TPYDLDLNQSLPLTTNSLINNLYADNTDLFGRNDNPLPSYESVVLSQSTTSLGPRMIKVK
LLGVTIDKDLKFDDHIKSLCGKANGKRFALARIRSFLSVKEATVLFNAFMLSNFSYCPLI
WMFCSKYNNNLINKIHEKGLRIVYKKFDIPLEEIQKIENIPSIHLRNLSLKIPRSKVGVF
RQKISETNMLNAVNFVLQQKMSLSEAAKHFNIKKSTLRYQLKQFKKPGSCEYLYSLTKPK
KIFSTEEELILVNYLTDAANMHYGPALKQIRSFAYEYALKNH
Download sequence
Identical sequences gi|449668438|ref|XP_004206787.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]